Austin Richardson audy
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| <html> | |
| <head> | |
| <title>Dear Diary</title> | |
| <style type="text/css"> | |
| body { | |
| background-image:url("http://media.thatguys.co.uk/uploaded_images/Dinosaur-disney-screenshot-789279.jpg"); | |
| font: "Helvetica"; | |
| } | |
| h1 { |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| >gi|15803490|ref|NP_289523.1| hypothetical protein Z4296 [Escherichia coli O157:H7 EDL933] | |
| MNDIAHNLAQVRDKISAAATRCGRSPEEITLLAVSKTKPASAIAEAIDAGQRQFGENYVQEGVDKIRHFQ | |
| ELGVTGLEWHFIGPLQSNKSRLVAEHFDWCHTIDRLRIATRLNDQRPAELPPLNVLIQINISDENSKSGI | |
| QLAELDELAAAVAELPRLRLRGLMAIPAPESEYVRQFEVARQMAVAFAGLKTRYPHIDTLSLGMSDDMEA | |
| AIAAGSTMVRIGTAIFGARDYSKK | |
| >gi|197284237|ref|YP_002150109.1| amino acid racemase [Proteus mirabilis HI4320] | |
| MNTIKQNLVNVRSHIDTAAQKCGRSPDEITLLAVSKTKPVSDIEKAIACGQTEFGENYVQEGVDKISYFA | |
| ENKNLVWHFIGPLQSNKTRLVAEHFAWCHTIDRLKIAQRLSDQRPTTLPPLNVLIQINISDENSKSGISL | |
| TELDGLAAQISILPGIKLRGLMAIPAPENDYNKQVEVLEKMHQAFKQLQNQYPDIDTLSMGMTGDMEAAI |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| >gi|15803490|ref|NP_289523.1| hypothetical protein Z4296 [Escherichia coli O157:H7 EDL933] | |
| MNDIAHNLAQVRDKISAAATRCGRSPEEITLLAVSKTKPASAIAEAIDAGQRQFGENYVQEGVDKIRHFQ | |
| ELGVTGLEWHFIGPLQSNKSRLVAEHFDWCHTIDRLRIATRLNDQRPAELPPLNVLIQINISDENSKSGI | |
| QLAELDELAAAVAELPRLRLRGLMAIPAPESEYVRQFEVARQMAVAFAGLKTRYPHIDTLSLGMSDDMEA | |
| AIAAGSTMVRIGTAIFGARDYSKK | |
| >gi|86146413|ref|ZP_01064737.1| Predicted enzyme with a TIM-barrel fold [Vibrio sp. MED222] | |
| MSSIQQNIEQITSQIRSAEQKCGRAPDSVQLLAVSKTKPIDAILEAALGGQVAFGENYVQEGVDKVKHFS | |
| EQHSNLNLEWHFIGPIQSNKTRPIAESFQWVHSVDRDKIAQRLHDQRPNELPPLQVLIQVNTSGEDSKSG | |
| TSEETVFALAELISSLPNLTLRGLMSIPANVSDYQSQLKAFSQLADLQQKLAAKYPDIDTLSMGMSGDMD |
audy
/ unknown.pdb
Created
November 23, 2010 14:08
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| PFRMAT TS | |
| TARGET Undefined | |
| AUTHOR Phyre-1 | |
| REMARK Quick Phyre Results | |
| REMARK Job Description: Undefined | |
| REMARK Unique Job identifier: c174463da7096328 | |
| REMARK | |
| REMARK This data has been generated by the Phyre web server | |
| REMARK Structural Bioinformatics Group | |
| REMARK Imperial College London |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| #!/usr/bin/env python | |
| # Shannon Diversity Index | |
| # http://en.wikipedia.org/wiki/Shannon_index | |
| import sys | |
| def sdi(data): | |
| """ Given a hash { 'species': count } , returns the SDI | |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| # Use a class: | |
| class playlistFactory: | |
| API_KEY = "..." | |
| SECRET = "..." | |
| def __init__(self, query): | |
| self.query = query | |
| def get_song(): |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| #!/usr/bin/env python | |
| from ruffus import * | |
| import os | |
| files = [ ('data/a.fasta', 'data/b.fasta'), ('data/c.fasta', 'data/d.fasta') ] | |
| @transform(files, suffix('.fasta'), '.out') | |
| def combine(infiles, outfile): | |
| a, b = files |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| class AutoVivification(dict): | |
| def __getitem__(self, item): | |
| try: | |
| return dict.__getitem__(self, item) | |
| except KeyError: | |
| value = self[item] = type(self)() | |
| return value | |
| data = AutoVivification() |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| #!/usr/bin/env python | |
| from glob import glob | |
| from PIL import Image, ImageDraw | |
| from itertools import defaultdict | |
| # Create matrix | |
| matrix = defaultdict(dict) | |
| lanes = [1, 2, 3, 4, 5, 6, 7] |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| /usr/lib/ruby/gems/1.9.1/gems/instiki-0.10.2/instiki:6:in `load': /usr/lib/ruby/gems/1.9.1/gems/instiki-0.10.2/script/server:27: formal argument cannot be a constant (SyntaxError) | |
| 'Default: 2500') { |OPTIONS[:port]| } | |
| ^ | |
| /usr/lib/ruby/gems/1.9.1/gems/instiki-0.10.2/script/server:27: syntax error, unexpected '[', expecting '|' | |
| 'Default: 2500') { |OPTIONS[:port]| } | |
| ^ | |
| /usr/lib/ruby/gems/1.9.1/gems/instiki-0.10.2/script/server:30: formal argument cannot be a constant | |
| 'Default: 0.0.0.0') { |OPTIONS[:ip]| } | |
| ^ | |
| /usr/lib/ruby/gems/1.9.1/gems/instiki-0.10.2/script/server:30: syntax error, unexpected '[', expecting '|' |