This file has been truncated, but you can view the full file.
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| >NZ_CP070290.1_1-5000 | |
| GTGTCACTTTCGCTTTGGCAGCAGTGTCTTGCCCGATTGCAGGATGAGTTACCAGCCACA | |
| GAATTCAGTATGTGGATACGCCCGTTGCAGGCGGAACTGAGCGATAACACGCTGGCCTTG | |
| TACGCGCCAAATCGTTTTGTCCTCGATTGGGTACGGGACAAGTACCTCAATAATATCAAT | |
| GGACTGCTAACCAGCTTCTGTGGCGCGGATGCCCCACAGTTGCGCTTTGAAGTTGGCACC | |
| AGGCCGGTGACGAAAACCTCTCAGGCCGCAGTGACGAGCAACGTTACAGCGCCAGCTCAG | |
| GTGGCGCAAATGCAACCGCAGCGCGCTGCGCCTGCAGCGCGTTCGGGTTGGGATAACGTT | |
| CCTGCTCCGGCGGAACCGACCTATCGTTCCAACGTCAACGTCAAACATACGTTTGATAAC | |
| TTCGTCGAAGGTAAATCTAACCAACTGGCGCGCGCGGCGGCTCGCCAGGTGGCGGATAAC | |
| CCCGGTGGCGCTTATAACCCGCTGTTCCTTTATGGCGGCACGGGTCTGGGTAAAACTCAC |
This file has been truncated, but you can view the full file.
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| >NZ_JADOTX010000001.1_1-5000_1 | |
| PGPHRRYGADLVVPRLVRAQCALLKGIALRYVMRRSGFRGRYERQRTMLAEVVAALVRRA | |
| PEGLDPIFAPLWRAAPDDTARLRVVIDQVASLTDPAAVTWHTRLVGNGTPLTDN* | |
| >NZ_JADOTX010000001.1_1-5000_2 | |
| MTERPRNVTSAQVLRTERPTPHLIRLVLGGDELVGLPVGEFTDHYIKVVFPQPGVAYPQP | |
| LDLAAIRRDLPREQWPRLRAYTVRRWDPLAGELTVDVVHHGDEGLAGPWAAALRPGDPVH | |
| FVGPGGAYAPSPDADWHLLVGDESALPAIAAALERLPLGARAHVFVEIADPAEEQKLLSP | |
| GAVELTWLHRGDRPVGEALVAAVRALEFPAGQVHAFVHGEAAFVRELRRLLRGERGIPLG | |
| QLSISGYWRRGMDDEGWRSTKADWNQQVAAEEVAVAAA* | |
| >NZ_JADOTX010000001.1_1-5000_3 |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| #!/usr/bin/env python | |
| # Import Module | |
| import argparse | |
| import ftplib | |
| from tqdm import tqdm | |
| import requests | |
| from pathlib import Path | |
| import logging | |
| import multiprocessing | |
| import csv |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| # See ftp://ftp.ncbi.nlm.nih.gov/genomes/README_assembly_summary.txt for a description of the columns in this file. | |
| # assembly_accession bioproject biosample wgs_master refseq_category taxid species_taxid organism_name infraspecific_name isolate version_status assembly_level release_type genome_rep seq_rel_date asm_name submitter gbrs_paired_asm paired_asm_comp ftp_path excluded_from_refseq relation_to_type_material asm_not_live_date | |
| GCF_000001215.4 PRJNA164 SAMN02803731 reference genome 7227 7227 Drosophila melanogaster latest Chromosome Major Full 2014/08/01 Release 6 plus ISO1 MT The FlyBase Consortium/Berkeley Drosophila Genome Project/Celera Genomics GCA_000001215.4 identical https://ftp.ncbi.nlm.nih.gov/genomes/all/GCF/000/001/215/GCF_000001215.4_Release_6_plus_ISO1_MT na | |
| GCF_000001405.40 PRJNA168 reference genome 9606 9606 Homo sapiens latest Chromosome Patch Full 2022/02/03 GRCh38.p14 Genome Reference Consortium GCA_000001405.29 different https://ftp.ncbi.nlm.nih.gov/genomes/all/GCF/000/001 |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| #!/usr/bin/env python3 | |
| # script to find and download genomes associated with mibig | |
| from pathlib import Path | |
| import os | |
| import hashlib | |
| import requests | |
| import csv | |
| import argparse |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| from collections import defaultdict | |
| from pathlib import Path | |
| prompt_data = "/home/chase/Downloads/input.txt" | |
| with open(prompt_data) as fp: | |
| lines = fp.readlines() | |
| cleaned=[] |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| <?xml version='1.0' encoding='UTF-8'?> | |
| <rdf:RDF xml:base="http://purl.uniprot.org/uniprot/" xmlns="http://purl.uniprot.org/core/" xmlns:ECO="http://purl.obolibrary.org/obo/ECO_" xmlns:annotation="http://purl.uniprot.org/annotation/" xmlns:citation="http://purl.uniprot.org/citations/" xmlns:dcterms="http://purl.org/dc/terms/" xmlns:disease="http://purl.uniprot.org/diseases/" xmlns:enzyme="http://purl.uniprot.org/enzyme/" xmlns:faldo="http://biohackathon.org/resource/faldo#" xmlns:foaf="http://xmlns.com/foaf/0.1/" xmlns:go="http://purl.obolibrary.org/obo/GO_" xmlns:isoform="http://purl.uniprot.org/isoforms/" xmlns:keyword="http://purl.uniprot.org/keywords/" xmlns:location="http://purl.uniprot.org/locations/" xmlns:owl="http://www.w3.org/2002/07/owl#" xmlns:position="http://purl.uniprot.org/position/" xmlns:pubmed="http://purl.uniprot.org/pubmed/" xmlns:range="http://purl.uniprot.org/range/" xmlns:rdf="http://www.w3.org/1999/02/22-rdf-syntax-ns#" xmlns:rdfs="http://www.w3.org/2000/01/rdf-schema#" xmlns:skos="htt |
This file has been truncated, but you can view the full file.
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| <?xml version='1.0' encoding='UTF-8'?> | |
| <rdf:RDF xmlns="http://purl.uniprot.org/core/" xmlns:dcterms="http://purl.org/dc/terms/" xmlns:foaf="http://xmlns.com/foaf/0.1/" xmlns:owl="http://www.w3.org/2002/07/owl#" xmlns:rdf="http://www.w3.org/1999/02/22-rdf-syntax-ns#" xmlns:rdfs="http://www.w3.org/2000/01/rdf-schema#" xmlns:skos="http://www.w3.org/2004/02/skos/core#"> | |
| <owl:Ontology rdf:about=""> | |
| <owl:imports rdf:resource="http://purl.uniprot.org/core/"/> | |
| </owl:Ontology> | |
| <rdf:Description rdf:about="http://purl.uniprot.org/enzyme/1.-.-.-"> | |
| <rdf:type rdf:resource="http://purl.uniprot.org/core/Enzyme"/> | |
| <skos:prefLabel>Oxidoreductases</skos:prefLabel> | |
| <rdfs:subClassOf rdf:resource="http://purl.uniprot.org/core/Enzyme"/> | |
| <skos:narrowerTransitive rdf:resource="http://purl.uniprot.org/enzyme/1.1.-.-"/> |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| #!/usr/bin/env Rscript | |
| if (!require("remotes")) { | |
| install.packages("remotes") | |
| library(remotes) | |
| } | |
| if (!require("DBI")) { | |
| install.packages("DBI") | |
| library(DBI) | |
| } | |
| if (!require("RSQLite")) { |
This file has been truncated, but you can view the full file.
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| HMMER3/f [3.1b2 | February 2015] | |
| NAME adh_short | |
| ACC PF00106.28 | |
| DESC short chain dehydrogenase | |
| LENG 195 | |
| ALPH amino | |
| RF no | |
| MM no | |
| CONS yes | |
| CS yes |