<script type="module" src="https://togostanza.github.io/openstanza/manhattan-plot.js" async></script>
<togostanza-manhattan-plot
data-url="https://raw.githubusercontent.com/togostanza/openstanza/main/stanzas/manhattan-plot/assets/manhattan-plot.json"
chromosomeKey="chr"
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
{ | |
"head": { | |
"link": [], | |
"vars": [ | |
"hgnc_uri", | |
"gene_symbol", | |
"approved_name", | |
"chromosomal_location", | |
"alias", | |
"ncbigene", |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
[ | |
{ | |
"refex_id": "RFX0000113860", | |
"ex_value": "7.4464837623184", | |
"see_also": "http://www.ncbi.nlm.nih.gov/gene/308", | |
"RefExSample": "http://refex.dbcls.jp/sample/RES00000436", | |
"sample_id": "RES00000436", | |
"taxonomy": "http://identifiers.org/taxonomy/9606", | |
"age": "21", | |
"stage": "adult", |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
series | key | value | |
---|---|---|---|
2021-01-01 | 1 | 0 | |
2021-01-01 | 1.38.1 | 0 | |
2021-01-01 | 1.38.1.3 | 0 | |
2021-01-01 | 1.38.1.4 | 0 | |
2021-01-01 | 1.1 | 0 | |
2021-01-02 | 1 | 0 | |
2021-01-02 | 1.38.1 | 0 | |
2021-01-02 | 1.38.1.3 | 0 | |
2021-01-02 | 1.38.1.4 | 0 |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
series | key | value | |
---|---|---|---|
2020-12-28 | 1 | 0 | |
2020-12-28 | 1.38.1 | 0 | |
2020-12-28 | 1.38.1.3 | 0 | |
2020-12-28 | 1.38.1.4 | 0 | |
2020-12-28 | 1.1 | 0 | |
2021-01-04 | 1 | 0 | |
2021-01-04 | 1.38.1 | 0 | |
2021-01-04 | 1.38.1.3 | 0 | |
2021-01-04 | 1.38.1.4 | 0 |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
swagger: '2.0' | |
info: | |
title: Togo ID API | |
version: 2.0.0 | |
host: api.togoid.dbcls.jp.il3c.com | |
schemes: | |
- https | |
produces: | |
- application/json | |
tags: |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
source | route | target | |
---|---|---|---|
ensembl_gene | uniprot,reactome_reaction | chebi | |
ensembl_gene | uniprot,reactome_reaction,chebi | chembl_compound | |
ensembl_gene | uniprot | chembl_target | |
ensembl_gene | uniprot | glytoucan | |
ensembl_gene | hgnc | ||
ensembl_gene | ncbigene,medgen | hp | |
ensembl_gene | ncbigene | medgen | |
ensembl_gene | ncbigene,medgen | mesh | |
ensembl_gene | ncbigene,medgen | mondo |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
[ | |
{ | |
"id": 0, | |
"value": "My Home", | |
"label": "My Home", | |
"children": [1, 31, 39] | |
}, | |
{ | |
"id": 1, | |
"value": "transcript_variant", |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
{ | |
"nodes": [ | |
{"id": "Myriel", "group": "壱"}, | |
{"id": "Napoleon", "group": "壱"}, | |
{"id": "Mlle.Baptistine", "group": "壱"}, | |
{"id": "Mme.Magloire", "group": "壱"}, | |
{"id": "CountessdeLo", "group": "壱"}, | |
{"id": "Geborand", "group": "壱"}, | |
{"id": "Champtercier", "group": "壱"}, | |
{"id": "Cravatte", "group": "壱"}, |
We can't make this file beautiful and searchable because it's too large.
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Species,TaxID,Protein tag sequence | |
Aaosphaeria arxii,1450171,LREIVMTASAKISTPSMQLYPREELSIADCEKFAKSISRLPLSSVLDKVTITEELGQGTAIQQARKFKIRMDFYPAKEYTAEYAIKVRDVAESLEKKFCPRLHKVIRADLKKQQANRSLSTASSASVPQVGQSSGTIEQATTRTADNEGGRDDDESDDGDDDGDATNAKQRGRRAESVEFEAPDEDEEQIIDRIRTEGSDEEDETYGGSPKPSRAASPDQDSDSEDEETVVAREEASDIRRDRILKACGDVYDFRFDDKAGGFCEIYLEYPAEAPKVLMLNHVEATAEFATIHVIPGIKSAQVTTEKVPDPVTGEEVKKVTGIITEGANLVAMQDYPHIVDTNRLFTNDIALMLRLYGVEACRATIVREMHAVFSGH | |
Abies balsamea,90345,LREILMTASKKILTPVMTCPLRKGKTREDAERLAAKLRRIRFADLIQSLDIGIVPFSVSNGHVQTVYKLRIKLYPPAFYPQYSNLSLVDCEKTFRNQYIEVLGKEIDIALKKARKSGQEAVQIVSEPLPMDGSGVTSEDESQVNLNSREQTEDEDEQDDEAEDEGADAQKRKSQGTDVMDYDDENDEDEMSMVENICNEENSLEEDDVDNRSDVHNEAVEDEDIEEENSSKTVKASRSAEKKSNESLKESKKVKKKSKKDKTEATGVIIKGTTFEVHFPVERNTHILLAPIAEKVAKKVFVHSVDNIDRCSVIDYNGDSNVPALQTDGINFKVLWMRSDELDINRLTTNDINAMLEVYGVESARATIVAEVKGVFDSY | |
Abies lasiocarpa,34340,LREILMTASKKILTPVMTCPLRKGKTREDAERLAAKLRRIRFADLIQSLDIGIVPFSVSNGHVQTVYKLRIKLYPPAFYPQYSNLSLVDCEKTFRNQYIEVLGKEIDIALKKARKSGQEAVQIVSEPLPMDGSGVTSEDESQVNLNSREQTEDEDEQDDEAE |