Toshiaki Katayama ktym
ktym
/ darkgenes.txt
Created
October 17, 2023 06:26
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| OR4F5 | |
| AGRN | |
| RNF207 | |
| TNFRSF25 | |
| MASP2 | |
| CLCN6 | |
| PADI4 | |
| GALE | |
| FUCA1 | |
| RHCE |
ktym
/ darkgenes.json
Created
October 17, 2023 04:53
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| { | |
| "A4GALT": "18149", | |
| "ABCG8": "13887", | |
| "ABI1": "11320", | |
| "ABO": "79", | |
| "ACSBG2": "24174", | |
| "ADAMTS10": "13201", | |
| "ADAMTSL2": "14631", | |
| "AFP": "317", | |
| "AGL": "321", |
ktym
/ bh23.9.json
Last active
September 26, 2023 02:08
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| [ | |
| { | |
| "category": "建築家", | |
| "type": "JP", | |
| "count": 3.69 | |
| }, | |
| { | |
| "category": "論理学者", | |
| "type": "JP", | |
| "count": 7.19 |
ktym
/ Eukaryotes.csv
Created
February 22, 2023 05:46
We can't make this file beautiful and searchable because it's too large.
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| Species,TaxID,Protein tag sequence | |
| Aaosphaeria arxii,1450171,LREIVMTASAKISTPSMQLYPREELSIADCEKFAKSISRLPLSSVLDKVTITEELGQGTAIQQARKFKIRMDFYPAKEYTAEYAIKVRDVAESLEKKFCPRLHKVIRADLKKQQANRSLSTASSASVPQVGQSSGTIEQATTRTADNEGGRDDDESDDGDDDGDATNAKQRGRRAESVEFEAPDEDEEQIIDRIRTEGSDEEDETYGGSPKPSRAASPDQDSDSEDEETVVAREEASDIRRDRILKACGDVYDFRFDDKAGGFCEIYLEYPAEAPKVLMLNHVEATAEFATIHVIPGIKSAQVTTEKVPDPVTGEEVKKVTGIITEGANLVAMQDYPHIVDTNRLFTNDIALMLRLYGVEACRATIVREMHAVFSGH | |
| Abies balsamea,90345,LREILMTASKKILTPVMTCPLRKGKTREDAERLAAKLRRIRFADLIQSLDIGIVPFSVSNGHVQTVYKLRIKLYPPAFYPQYSNLSLVDCEKTFRNQYIEVLGKEIDIALKKARKSGQEAVQIVSEPLPMDGSGVTSEDESQVNLNSREQTEDEDEQDDEAEDEGADAQKRKSQGTDVMDYDDENDEDEMSMVENICNEENSLEEDDVDNRSDVHNEAVEDEDIEEENSSKTVKASRSAEKKSNESLKESKKVKKKSKKDKTEATGVIIKGTTFEVHFPVERNTHILLAPIAEKVAKKVFVHSVDNIDRCSVIDYNGDSNVPALQTDGINFKVLWMRSDELDINRLTTNDINAMLEVYGVESARATIVAEVKGVFDSY | |
| Abies lasiocarpa,34340,LREILMTASKKILTPVMTCPLRKGKTREDAERLAAKLRRIRFADLIQSLDIGIVPFSVSNGHVQTVYKLRIKLYPPAFYPQYSNLSLVDCEKTFRNQYIEVLGKEIDIALKKARKSGQEAVQIVSEPLPMDGSGVTSEDESQVNLNSREQTEDEDEQDDEAE |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| { | |
| "nodes": [ | |
| {"id": "Myriel", "group": "壱"}, | |
| {"id": "Napoleon", "group": "壱"}, | |
| {"id": "Mlle.Baptistine", "group": "壱"}, | |
| {"id": "Mme.Magloire", "group": "壱"}, | |
| {"id": "CountessdeLo", "group": "壱"}, | |
| {"id": "Geborand", "group": "壱"}, | |
| {"id": "Champtercier", "group": "壱"}, | |
| {"id": "Cravatte", "group": "壱"}, |
ktym
/ tree-data.json
Last active
December 28, 2022 05:53
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| [ | |
| { | |
| "id": 0, | |
| "value": "My Home", | |
| "label": "My Home", | |
| "children": [1, 31, 39] | |
| }, | |
| { | |
| "id": 1, | |
| "value": "transcript_variant", |
ktym
/ togodx-idconvert-route.tsv
Last active
May 17, 2022 10:21
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| source | route | target | |
|---|---|---|---|
| ensembl_gene | uniprot,reactome_reaction | chebi | |
| ensembl_gene | uniprot,reactome_reaction,chebi | chembl_compound | |
| ensembl_gene | uniprot | chembl_target | |
| ensembl_gene | uniprot | glytoucan | |
| ensembl_gene | hgnc | ||
| ensembl_gene | ncbigene,medgen | hp | |
| ensembl_gene | ncbigene | medgen | |
| ensembl_gene | ncbigene,medgen | mesh | |
| ensembl_gene | ncbigene,medgen | mondo |
ktym
/ swagger-config.yaml
Last active
March 17, 2022 07:21
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| swagger: '2.0' | |
| info: | |
| title: Togo ID API | |
| version: 2.0.0 | |
| host: api.togoid.dbcls.jp.il3c.com | |
| schemes: | |
| - https | |
| produces: | |
| - application/json | |
| tags: |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| series | key | value | |
|---|---|---|---|
| 2020-12-28 | 1 | 0 | |
| 2020-12-28 | 1.38.1 | 0 | |
| 2020-12-28 | 1.38.1.3 | 0 | |
| 2020-12-28 | 1.38.1.4 | 0 | |
| 2020-12-28 | 1.1 | 0 | |
| 2021-01-04 | 1 | 0 | |
| 2021-01-04 | 1.38.1 | 0 | |
| 2021-01-04 | 1.38.1.3 | 0 | |
| 2021-01-04 | 1.38.1.4 | 0 |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| series | key | value | |
|---|---|---|---|
| 2021-01-01 | 1 | 0 | |
| 2021-01-01 | 1.38.1 | 0 | |
| 2021-01-01 | 1.38.1.3 | 0 | |
| 2021-01-01 | 1.38.1.4 | 0 | |
| 2021-01-01 | 1.1 | 0 | |
| 2021-01-02 | 1 | 0 | |
| 2021-01-02 | 1.38.1 | 0 | |
| 2021-01-02 | 1.38.1.3 | 0 | |
| 2021-01-02 | 1.38.1.4 | 0 |