<script type="module" src="https://togostanza.github.io/openstanza/manhattan-plot.js" async></script>
<togostanza-manhattan-plot
data-url="https://raw.githubusercontent.com/togostanza/openstanza/main/stanzas/manhattan-plot/assets/manhattan-plot.json"
chromosomeKey="chr"
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
{ | |
"A4GALT": "18149", | |
"ABCG8": "13887", | |
"ABI1": "11320", | |
"ABO": "79", | |
"ACSBG2": "24174", | |
"ADAMTS10": "13201", | |
"ADAMTSL2": "14631", | |
"AFP": "317", | |
"AGL": "321", |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
[ | |
{ | |
"category": "建築家", | |
"type": "JP", | |
"count": 3.69 | |
}, | |
{ | |
"category": "論理学者", | |
"type": "JP", | |
"count": 7.19 |
We can't make this file beautiful and searchable because it's too large.
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Species,TaxID,Protein tag sequence | |
Aaosphaeria arxii,1450171,LREIVMTASAKISTPSMQLYPREELSIADCEKFAKSISRLPLSSVLDKVTITEELGQGTAIQQARKFKIRMDFYPAKEYTAEYAIKVRDVAESLEKKFCPRLHKVIRADLKKQQANRSLSTASSASVPQVGQSSGTIEQATTRTADNEGGRDDDESDDGDDDGDATNAKQRGRRAESVEFEAPDEDEEQIIDRIRTEGSDEEDETYGGSPKPSRAASPDQDSDSEDEETVVAREEASDIRRDRILKACGDVYDFRFDDKAGGFCEIYLEYPAEAPKVLMLNHVEATAEFATIHVIPGIKSAQVTTEKVPDPVTGEEVKKVTGIITEGANLVAMQDYPHIVDTNRLFTNDIALMLRLYGVEACRATIVREMHAVFSGH | |
Abies balsamea,90345,LREILMTASKKILTPVMTCPLRKGKTREDAERLAAKLRRIRFADLIQSLDIGIVPFSVSNGHVQTVYKLRIKLYPPAFYPQYSNLSLVDCEKTFRNQYIEVLGKEIDIALKKARKSGQEAVQIVSEPLPMDGSGVTSEDESQVNLNSREQTEDEDEQDDEAEDEGADAQKRKSQGTDVMDYDDENDEDEMSMVENICNEENSLEEDDVDNRSDVHNEAVEDEDIEEENSSKTVKASRSAEKKSNESLKESKKVKKKSKKDKTEATGVIIKGTTFEVHFPVERNTHILLAPIAEKVAKKVFVHSVDNIDRCSVIDYNGDSNVPALQTDGINFKVLWMRSDELDINRLTTNDINAMLEVYGVESARATIVAEVKGVFDSY | |
Abies lasiocarpa,34340,LREILMTASKKILTPVMTCPLRKGKTREDAERLAAKLRRIRFADLIQSLDIGIVPFSVSNGHVQTVYKLRIKLYPPAFYPQYSNLSLVDCEKTFRNQYIEVLGKEIDIALKKARKSGQEAVQIVSEPLPMDGSGVTSEDESQVNLNSREQTEDEDEQDDEAE |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
{ | |
"nodes": [ | |
{"id": "Myriel", "group": "壱"}, | |
{"id": "Napoleon", "group": "壱"}, | |
{"id": "Mlle.Baptistine", "group": "壱"}, | |
{"id": "Mme.Magloire", "group": "壱"}, | |
{"id": "CountessdeLo", "group": "壱"}, | |
{"id": "Geborand", "group": "壱"}, | |
{"id": "Champtercier", "group": "壱"}, | |
{"id": "Cravatte", "group": "壱"}, |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
[ | |
{ | |
"id": 0, | |
"value": "My Home", | |
"label": "My Home", | |
"children": [1, 31, 39] | |
}, | |
{ | |
"id": 1, | |
"value": "transcript_variant", |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
source | route | target | |
---|---|---|---|
ensembl_gene | uniprot,reactome_reaction | chebi | |
ensembl_gene | uniprot,reactome_reaction,chebi | chembl_compound | |
ensembl_gene | uniprot | chembl_target | |
ensembl_gene | uniprot | glytoucan | |
ensembl_gene | hgnc | ||
ensembl_gene | ncbigene,medgen | hp | |
ensembl_gene | ncbigene | medgen | |
ensembl_gene | ncbigene,medgen | mesh | |
ensembl_gene | ncbigene,medgen | mondo |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
swagger: '2.0' | |
info: | |
title: Togo ID API | |
version: 2.0.0 | |
host: api.togoid.dbcls.jp.il3c.com | |
schemes: | |
- https | |
produces: | |
- application/json | |
tags: |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
series | key | value | |
---|---|---|---|
2020-12-28 | 1 | 0 | |
2020-12-28 | 1.38.1 | 0 | |
2020-12-28 | 1.38.1.3 | 0 | |
2020-12-28 | 1.38.1.4 | 0 | |
2020-12-28 | 1.1 | 0 | |
2021-01-04 | 1 | 0 | |
2021-01-04 | 1.38.1 | 0 | |
2021-01-04 | 1.38.1.3 | 0 | |
2021-01-04 | 1.38.1.4 | 0 |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
series | key | value | |
---|---|---|---|
2021-01-01 | 1 | 0 | |
2021-01-01 | 1.38.1 | 0 | |
2021-01-01 | 1.38.1.3 | 0 | |
2021-01-01 | 1.38.1.4 | 0 | |
2021-01-01 | 1.1 | 0 | |
2021-01-02 | 1 | 0 | |
2021-01-02 | 1.38.1 | 0 | |
2021-01-02 | 1.38.1.3 | 0 | |
2021-01-02 | 1.38.1.4 | 0 |