This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| S CYP21A2 * LN:i:495 ng:i:144 nc:i:150 c1:i:144 c2:i:0 pp:Z:CYP21A2 | |
| S C4B_2 * LN:i:1744 ng:i:83 nc:i:86 c1:i:47 c2:i:85 pp:Z:C4B_2 | |
| S NELFE * LN:i:380 ng:i:29 nc:i:29 c1:i:29 c2:i:0 pp:Z:NELFE | |
| S STK19 * LN:i:254 ng:i:125 nc:i:126 c1:i:125 c2:i:0 pp:Z:STK19 | |
| S DXO * LN:i:396 ng:i:122 nc:i:123 c1:i:122 c2:i:0 pp:Z:DXO | |
| S SKIC2 * LN:i:1246 ng:i:107 nc:i:108 c1:i:107 c2:i:0 pp:Z:SKIC2 | |
| S C4A * LN:i:1744 ng:i:63 nc:i:71 c1:i:61 c2:i:71 pp:Z:C4A | |
| L CYP21A2 + C4B_2 + 0M ng:i:6 nc:i:6 ad:i:17245 s1:i:2469 s2:i:8012 | |
| L CYP21A2 + C4A + 0M ng:i:4 nc:i:4 ad:i:17716 s1:i:2445 s2:i:7862 | |
| L CYP21A2 - C4B_2 - 0M ng:i:70 nc:i:70 ad:i:12750 s1:i:2588 s2:i:8134 |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| OR4F5 | |
| AGRN | |
| RNF207 | |
| TNFRSF25 | |
| MASP2 | |
| CLCN6 | |
| PADI4 | |
| GALE | |
| FUCA1 | |
| RHCE |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| { | |
| "A4GALT": "18149", | |
| "ABCG8": "13887", | |
| "ABI1": "11320", | |
| "ABO": "79", | |
| "ACSBG2": "24174", | |
| "ADAMTS10": "13201", | |
| "ADAMTSL2": "14631", | |
| "AFP": "317", | |
| "AGL": "321", |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| [ | |
| { | |
| "category": "建築家", | |
| "type": "JP", | |
| "count": 3.69 | |
| }, | |
| { | |
| "category": "論理学者", | |
| "type": "JP", | |
| "count": 7.19 |
We can't make this file beautiful and searchable because it's too large.
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| Species,TaxID,Protein tag sequence | |
| Aaosphaeria arxii,1450171,LREIVMTASAKISTPSMQLYPREELSIADCEKFAKSISRLPLSSVLDKVTITEELGQGTAIQQARKFKIRMDFYPAKEYTAEYAIKVRDVAESLEKKFCPRLHKVIRADLKKQQANRSLSTASSASVPQVGQSSGTIEQATTRTADNEGGRDDDESDDGDDDGDATNAKQRGRRAESVEFEAPDEDEEQIIDRIRTEGSDEEDETYGGSPKPSRAASPDQDSDSEDEETVVAREEASDIRRDRILKACGDVYDFRFDDKAGGFCEIYLEYPAEAPKVLMLNHVEATAEFATIHVIPGIKSAQVTTEKVPDPVTGEEVKKVTGIITEGANLVAMQDYPHIVDTNRLFTNDIALMLRLYGVEACRATIVREMHAVFSGH | |
| Abies balsamea,90345,LREILMTASKKILTPVMTCPLRKGKTREDAERLAAKLRRIRFADLIQSLDIGIVPFSVSNGHVQTVYKLRIKLYPPAFYPQYSNLSLVDCEKTFRNQYIEVLGKEIDIALKKARKSGQEAVQIVSEPLPMDGSGVTSEDESQVNLNSREQTEDEDEQDDEAEDEGADAQKRKSQGTDVMDYDDENDEDEMSMVENICNEENSLEEDDVDNRSDVHNEAVEDEDIEEENSSKTVKASRSAEKKSNESLKESKKVKKKSKKDKTEATGVIIKGTTFEVHFPVERNTHILLAPIAEKVAKKVFVHSVDNIDRCSVIDYNGDSNVPALQTDGINFKVLWMRSDELDINRLTTNDINAMLEVYGVESARATIVAEVKGVFDSY | |
| Abies lasiocarpa,34340,LREILMTASKKILTPVMTCPLRKGKTREDAERLAAKLRRIRFADLIQSLDIGIVPFSVSNGHVQTVYKLRIKLYPPAFYPQYSNLSLVDCEKTFRNQYIEVLGKEIDIALKKARKSGQEAVQIVSEPLPMDGSGVTSEDESQVNLNSREQTEDEDEQDDEAE |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| { | |
| "nodes": [ | |
| {"id": "Myriel", "group": "壱"}, | |
| {"id": "Napoleon", "group": "壱"}, | |
| {"id": "Mlle.Baptistine", "group": "壱"}, | |
| {"id": "Mme.Magloire", "group": "壱"}, | |
| {"id": "CountessdeLo", "group": "壱"}, | |
| {"id": "Geborand", "group": "壱"}, | |
| {"id": "Champtercier", "group": "壱"}, | |
| {"id": "Cravatte", "group": "壱"}, |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| [ | |
| { | |
| "id": 0, | |
| "value": "My Home", | |
| "label": "My Home", | |
| "children": [1, 31, 39] | |
| }, | |
| { | |
| "id": 1, | |
| "value": "transcript_variant", |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| source | route | target | |
|---|---|---|---|
| ensembl_gene | uniprot,reactome_reaction | chebi | |
| ensembl_gene | uniprot,reactome_reaction,chebi | chembl_compound | |
| ensembl_gene | uniprot | chembl_target | |
| ensembl_gene | uniprot | glytoucan | |
| ensembl_gene | hgnc | ||
| ensembl_gene | ncbigene,medgen | hp | |
| ensembl_gene | ncbigene | medgen | |
| ensembl_gene | ncbigene,medgen | mesh | |
| ensembl_gene | ncbigene,medgen | mondo |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| swagger: '2.0' | |
| info: | |
| title: Togo ID API | |
| version: 2.0.0 | |
| host: api.togoid.dbcls.jp.il3c.com | |
| schemes: | |
| - https | |
| produces: | |
| - application/json | |
| tags: |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| series | key | value | |
|---|---|---|---|
| 2020-12-28 | 1 | 0 | |
| 2020-12-28 | 1.38.1 | 0 | |
| 2020-12-28 | 1.38.1.3 | 0 | |
| 2020-12-28 | 1.38.1.4 | 0 | |
| 2020-12-28 | 1.1 | 0 | |
| 2021-01-04 | 1 | 0 | |
| 2021-01-04 | 1.38.1 | 0 | |
| 2021-01-04 | 1.38.1.3 | 0 | |
| 2021-01-04 | 1.38.1.4 | 0 |