Rintze M. Zelle, PhD rmzelle

Awesome! You've created a pull request to the Citation Styles Language styles repository. We'll get in touch soon (usually within a day or two). In the meantime, our automated test system will go ahead and run some checks on your pull request. In a few minutes you'll be notified of the test results.

If you haven't done so yet, please make sure your style validates and follows all our other Style Requirements.

To update the current pull request, visit the "Files changed" tab above, and click on the pencil icon (see below) in the top-right corner of your style to start editing.

If you need assistance at any point, please leave a comment and we'll get back to you (feel free to write in Dutch, English, French, German, Portuguese, or Spanish).

	this.setupCase = function () {
	return {
	"headers": {},
	"params": {
	"doc": "https://raw.githubusercontent.com/citation-style-language/styles/master/apa.csl",
	"schema": "https://raw.githubusercontent.com/citation-style-language/schema/v1.0.1/csl.rnc https://raw.githubusercontent.com/citation-style-language/schema/master/csl.sch",
	"parser": "xml",
	"laxtype": "yes",
	"level": "error",
	"out": "json",

	<?xml version="1.0" encoding="utf-8"?>
	<style xmlns="http://purl.org/net/xbiblio/csl" class="note" default-locale="nl-NL" version="1.0" demote-non-dropping-particle="sort-only">
	<info>
	<title>De Buck (Dutch) - old</title>
	<id>http://www.zotero.org/styles/de-buck-old</id>
	<link href="http://www.zotero.org/styles/de-buck-old" rel="self"/>
	<link href="http://www.zotero.org/styles/modern-humanities-research-association" rel="template"/>
	<link href="http://forums.zotero.org/discussion/13964/style-sheet-de-buck/" rel="documentation"/>
	<author>
	<name>Rombert Stapel</name>

	<?xml version="1.0" encoding="utf-8"?>
	<style xmlns="http://purl.org/net/xbiblio/csl" version="1.0" class="in-text" default-locale="en-GB" demote-non-dropping-particle="never" page-range-format="chicago" >
	<info>
	<title>SEI International Style (Author-Date)</title>
	<id>SEI-International-Style</id>
	<link href="http://www.sei-international.org" rel="self"/>
	<author>
	<name>Marion Davis</name>
	<email>[email protected]</email>
	</author>

	[JavaScript Error: "m is null" {file: "chrome://zotero/content/xpcom/citeproc.js" line: 1189}]

	[JavaScript Error: "m is null" {file: "chrome://zotero/content/xpcom/citeproc.js" line: 1189}]

	[JavaScript Error: "The style you have selected does not appear to be valid. If you have created this style yourself, please ensure that it passes validation as described at https://github.com/citation-style-language/styles/wiki/Validation. Alternatively, try selecting another style."]

	version => 4.0.29.7, platform => Win32, oscpu => Windows NT 6.1; WOW64, locale => en-US, appName => Firefox, appVersion => 45.0.2

	=========================================================

	<?xml version="1.0" encoding="utf-8"?>
	<style xmlns="http://purl.org/net/xbiblio/csl" class="in-text" version="1.0">
	<info>
	<title>Test</title>
	<id>test</id>
	<category citation-format="author-date"/>
	<updated>2016-01-15T03:58:00+00:00</updated>
	<rights license="http://creativecommons.org/licenses/by-sa/3.0/">This work is licensed under a Creative Commons Attribution-ShareAlike 3.0 License</rights>
	</info>
	<citation>

	require 'json'

	STYLE_ROOT = File.expand_path('../..', __FILE__)

	RENAMED_STYLES_KEYS = []
	RENAMED_STYLES_VALUES = []

	# Read renamed-styles.json
	begin
	renamed_styles = JSON.parse(File.join("#{STYLE_ROOT}", "renamed-styles.json"))

	##gff-version 3
	##sequence-region scaffold10_size537661 1 537661
	scaffold10_size537661 AUGUSTUS gene 745 1674 . - 0 ID=95_g3568;Name=RTM1_1;gene_id=95_g3568
	scaffold10_size537661 AUGUSTUS mRNA 745 1674 . - 0 Parent=95_g3568;gene_id=95_g3568;transcript_id=95_g3568.t1;product=Protein RTM1;locus_tag=95_g3568.1;accession=P40113;score=625;evalue=0.0;translation=MSNDSSGSEWELYRYTPSKGAAIALTVLFIVTTLIYSFQVVWDARKASKPEVDNPFDTPVDKCESITAISLGENYKKLTVRSTFSAFIPLFFGCIMEIVGYIARAVSSSNTKEIAPYVIQAVLLLIAPALYAATIYMLFGRLLHVMRCESLMIVSSRFGTSFFVFGDVVSFCLQAAGGGLMATVNGRTTGSNLITAGLVIQIVFFGVFIINEFRFSYSVARVCPFYRHISKKWWFLNLTLMLSSILIMVRSIVRLVEFVEGYDGFIISHEYFIYVFDAVPMLLAAIVFIVGSFFGNIFTTITECQSLKP
	scaffold10_size537661 AUGUSTUS exon 748 1674 0.93 - 0 Parent=95_g3568;gene_id=95_g3568;transcript_id=95_g3568.t1
	scaffold10_size537661 AUGUSTUS CDS 748 1674 0.93 - 0 Parent=95_g3568;Name=RTM1_1;gene_id=95_g3568;transcript_id=95_g3568.t1
	scaffold10_size537661 AUGUSTUS gene 2374 4626 . - 0 ID=95_g3569;Name=-;gene_id=95_g3569
	scaffold10_size537661 AUGUSTUS

	import gffutils
	import os

	genomeGFF = 'test.gff'
	genomeGFFdb = 'test.db'

	db = gffutils.create_db(genomeGFF, dbfn=genomeGFFdb, force=True, merge_strategy="merge")

	def generatorModifyFeatures(featureFamilies):
	for featureFamily in featureFamilies: