Last active
September 26, 2023 04:15
-
-
Save JoaoRodrigues/276f9ca0fdd9d0d37cda to your computer and use it in GitHub Desktop.
Very long script to match the chains of PDB files to a reference. Produces a lot of output per match: which chains match which, the seq. id, the RMS after iterative fitting, and the alignment with markers of seq and structural mismatch.
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
#!/usr/bin/env python | |
""" | |
Utility to match (and compare) PDB files. | |
On homo-multimers, will match chains sequentially. | |
Uses global sequence alignment to find equivalent positions | |
between the sequences. Also superimposes the structures based | |
on the alignments and outputs per-chain RMSDs. | |
Outputs several values, see the example: | |
|------------------------------- Matched Chains (Ref<>Mobi) | |
| | |
| |---------------------------- Full alignment seq. id | |
| | | |
| | |------------------ Gapless seq. id (aligment without edge gaps) | |
| | | | |
| | | |------- Chain RMSD (n. atoms used in RMS/total in chain) | |
[++] A<>A := 95.4% | 99.0% | 1.70A | |
+ --------------------------------------------------------- Sequence mismatch | |
MSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRL --- Reference Sequence (trimmed) | |
MSVPTDEAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRL --- Mobile Sequence (trimmed) | |
*************** * ------------------------------------------- Removed during RMS calculation | |
Written by {0} [{1}] | |
""" | |
from __future__ import print_function, division | |
from operator import itemgetter | |
import os | |
import sys | |
import tempfile | |
import warnings | |
try: | |
from Bio import BiopythonExperimentalWarning | |
warnings.filterwarnings('ignore', category=BiopythonExperimentalWarning) | |
from Bio.PDB import PDBParser, PDBIO, Select, Superimposer, StructureBuilder | |
from Bio import pairwise2 | |
from Bio.SubsMat import MatrixInfo as matlist | |
from Bio.Data.SCOPData import protein_letters_3to1 as aa3to1 | |
except ImportError as exception: | |
print("[!] Could not import Biopython modules", file=sys.stderr) | |
raise exception | |
__author__ = "Joao Rodrigues" | |
__email__ = "[email protected]" | |
# | |
def parse_structure(struct): | |
""" | |
Parses a PDB-formatted structure using the PDBParser module | |
of Biopython. Filters HETATMs and Waters. Returns a SMCRA object. | |
""" | |
sname = '.'.join(os.path.basename(struct).split('.')[:-1]) | |
full_path = os.path.abspath(struct) | |
if not os.path.isfile(full_path): | |
print('[!!] File not found or not readable'.format(struct), file=sys.stderr) | |
sys.exit(1) | |
s = parser.get_structure(sname, full_path) | |
# Ensemble check | |
if len(s) > 1: | |
print('[!!] {0} is an ensemble. Reading first model only. '.format(struct), file=sys.stderr) | |
class ModelSelector(Select): | |
def accept_model(self, model): | |
if model.id == 1: | |
return 1 | |
else: | |
return 0 | |
tempf = tempfile.NamedTemporaryFile() | |
io.set_structure(s) | |
io.save(tempf.name, ModelSelector()) | |
s = parser.get_structure(sname, tempf) | |
tempf.close() | |
# Double occupancy check | |
for atom in list(s.get_atoms()): | |
if atom.is_disordered(): | |
residue = atom.parent | |
sel_at = atom.selected_child | |
sel_at.altloc = ' ' | |
sel_at.disordered_flag = 0 | |
residue.detach_child(atom.id) | |
residue.add(sel_at) | |
# Remove HETATM and Solvent | |
res_list = list(s.get_residues()) | |
n_res = len(res_list) | |
_ignore = lambda r: r.id[0][0] == 'W' or r.id[0][0] == 'H' | |
for res in res_list: | |
if _ignore(res): | |
chain = res.parent | |
chain.detach_child(res.id) | |
nn_res = len(list(s.get_residues())) | |
# print('[+] Parsed PDB file {0} ({1}/{2} residues kept)'.format(struct, nn_res, n_res)) | |
return s | |
def _align_sequences(structA, structB, **kwargs): | |
""" | |
Performs a global pairwise alignment between two sequences | |
using the BLOSUM62 matrix and the Needleman-Wunsch algorithm | |
as implemented in Biopython. Returns the alignment, the sequence | |
identity and the residue mapping between both original sequences. | |
""" | |
def _calculate_identity(sequenceA, sequenceB): | |
""" | |
Returns the percentage of identical characters between two sequences. | |
Assumes the sequences are aligned. | |
""" | |
sa, sb, sl = sequenceA, sequenceB, len(sequenceA) | |
matches = [sa[i] == sb[i] for i in xrange(sl)] | |
seq_id = (100 * sum(matches)) / sl | |
gapless_sl = sum([1 for i in xrange(sl) if (sa[i] != '-' and sb[i] != '-')]) | |
gap_id = (100 * sum(matches)) / gapless_sl | |
return (seq_id, gap_id) | |
def _get_pdb_sequence(structure): | |
""" | |
Retrieves the AA sequence from a PDB structure. | |
""" | |
_aainfo = lambda r: (r.id[1], aa3to1.get(r.resname, 'X')) | |
seq = map(_aainfo, structure.get_residues()) | |
return seq | |
# | |
matrix = kwargs.get('matrix', matlist.blosum62) | |
gap_open = kwargs.get('gap_open', -10.0) | |
gap_extend = kwargs.get('gap_extend', -0.5) | |
trim_ends = kwargs.get('trim_ends', True) | |
resseq_A = _get_pdb_sequence(structA) | |
resseq_B = _get_pdb_sequence(structB) | |
sequence_A = ''.join(map(itemgetter(1), resseq_A)) | |
sequence_B = ''.join(map(itemgetter(1), resseq_B)) | |
alns = pairwise2.align.globalds(sequence_A, sequence_B, | |
matrix, gap_open, gap_extend, | |
penalize_end_gaps=(False, False) ) | |
best_aln = alns[0] | |
aligned_A, aligned_B, score, begin, end = best_aln | |
# Equivalent residue numbering | |
# Relative to reference | |
mapping = {} | |
aa_i_A, aa_i_B = 0, 0 | |
for aln_i, (aa_aln_A, aa_aln_B) in enumerate(zip(aligned_A, aligned_B)): | |
if aa_aln_A == '-': | |
if aa_aln_B != '-': | |
aa_i_B += 1 | |
elif aa_aln_B == '-': | |
if aa_aln_A != '-': | |
aa_i_A += 1 | |
else: | |
assert resseq_A[aa_i_A][1] == aa_aln_A | |
assert resseq_B[aa_i_B][1] == aa_aln_B | |
mapping[resseq_A[aa_i_A][0]] = resseq_B[aa_i_B][0] | |
aa_i_A += 1 | |
aa_i_B += 1 | |
# Gapless alignment | |
def _trimmer(sequence): | |
"""Returns indices of first and last ungapped position""" | |
leading = [i for (i, aa) in enumerate(sequence) if aa != '-'][0] | |
trailing = [i for (i, aa) in enumerate(sequence[::-1]) if aa != '-'][0] | |
trailing = len(sequence) - trailing | |
return (leading, trailing) | |
lead_A, trail_A = _trimmer(aligned_A) | |
lead_B, trail_B = _trimmer(aligned_B) | |
lead = max(lead_A, lead_B) | |
trail = min(trail_A, trail_B) | |
trim_aln_A = aligned_A[lead:trail] | |
trim_aln_B = aligned_B[lead:trail] | |
mismatch = ''.join(['+' if a!=b else ' ' for (a,b) in zip(trim_aln_A, trim_aln_B)]) | |
# Calculate (gapless) sequence identity | |
seq_id, g_seq_id = _calculate_identity(aligned_A, aligned_B) | |
return ((trim_aln_A, trim_aln_B, mismatch), seq_id, g_seq_id, mapping) | |
def match_chains(reference, mobile, min_id=30.0): | |
""" | |
Matches the chains of two different structures using | |
pairwise sequence alignment. Minimum sequence id is 30% | |
and minimum gapless is 90% (fixed). | |
""" | |
r_chains = list(reference.get_chains()) | |
m_chains = list(mobile.get_chains()) | |
chain_map = {} | |
_mapped = set() | |
for rc in r_chains: | |
best_id = min_id | |
for mc in m_chains: | |
# Naive check to avoid remapping chains | |
if mc.id in _mapped: | |
continue | |
aln, seq_id, gap_id, res_map = _align_sequences(rc, mc) | |
if seq_id > best_id and gap_id >= 90.0: | |
_mapped.add(mc.id) | |
# Remove previous chain mapped to this one | |
try: | |
_mapped.remove(chain_map[rc.id][0]) | |
except KeyError: # first assignment | |
pass | |
chain_map[rc.id] = (mc.id, seq_id, gap_id, aln, res_map) | |
best_id = seq_id | |
if seq_id == 100.0: | |
break | |
# if rc.id not in chain_map: | |
# print('[+++] {0} = No Match'.format(rc.id)) | |
# else: | |
# mc_id, seq_id, gap_id, _, _ = chain_map[rc.id] | |
# print('[+++] {0}<>{1} = {2:5.1f} | {3:5.1f}'.format(rc.id, mc_id, seq_id, gap_id)) | |
return chain_map | |
def match_structures(reference, mobile, mapping): | |
""" | |
Outputs fitted structures of 'trimmed' mobile structures, | |
renumbered to match the reference. | |
RMSD calculated only on matching residues. | |
""" | |
# Make empty structure | |
sb = StructureBuilder.StructureBuilder() | |
sb.init_structure(mobile.id) | |
sb.init_model(0) | |
sb.init_seg(' ') | |
# Rename matching residues/chains | |
for rc_id in mapping: | |
mc_id, _, _, _, c_map = mapping[rc_id] | |
mc = mobile[0][mc_id] | |
sb.init_chain(rc_id) | |
inv_c_map = dict([(v, k) for k, v in c_map.items()]) | |
mc_res_list = list(mc.get_residues()) | |
for res in mc_res_list: | |
if res.id[1] not in inv_c_map: | |
mc.detach_child(res.id) | |
else: | |
sb.init_residue(res.resname, res.id[0], inv_c_map[res.id[1]], res.id[2]) | |
for a in res: | |
sb.init_atom(a.name, a.coord, a.bfactor, a.occupancy, a.altloc, | |
a.fullname, a.serial_number, a.element) | |
mobile = sb.get_structure() | |
# Superimposer (iterative, discards atoms) | |
def _dist_per_atom(atoms_A, atoms_B): | |
""" | |
Calculates pairwise distances of atoms. | |
Returns indices of outliers (>av). | |
""" | |
dist = [i-j for (i,j) in zip(atoms_A, atoms_B)] | |
av = sum(dist) / len(dist) | |
outliers = [True if d > av else False for d in dist] | |
return outliers | |
n_trials = 0 | |
r_atoms = [r['CA'] for r in reference.get_residues() if r.parent.id in mapping and r.id[1] in mapping[r.parent.id][4]] | |
m_atoms = [r['CA'] for r in mobile.get_residues()] | |
ori_n_atoms = len(r_atoms) | |
while 1: | |
n_trials += 1 | |
super_imposer.set_atoms(r_atoms, m_atoms) | |
super_imposer.apply(mobile.get_atoms()) | |
n_atoms = len(r_atoms) | |
outliers = _dist_per_atom(r_atoms, m_atoms) | |
n_outliers = sum(outliers) | |
# print(n_trials, super_imposer.rms, n_outliers, n_atoms) | |
# Stop if less than 90% of starting atoms or less than 5 outliers OR after 3 trials | |
if n_atoms < ori_n_atoms*0.9 or n_outliers < 5 or n_trials == 3: | |
break | |
# Remove outliers for better RMS | |
r_atoms = [r for (r, o) in zip(r_atoms, outliers) if not o] | |
m_atoms = [r for (r, o) in zip(m_atoms, outliers) if not o] | |
# Build full list of outliers | |
_r_atoms = set(r_atoms) | |
r_atoms = [r['CA'] for r in reference.get_residues() if r.parent.id in mapping and r.id[1] in mapping[r.parent.id][4]] | |
m_atoms = [r['CA'] for r in mobile.get_residues()] | |
outliers = [r not in _r_atoms for r in r_atoms] | |
# Mark highest deviations in the sequence | |
# Calculate rms per chain (excl. outliers) | |
# chain: (distances, num outliers) | |
rms_info = dict([(c, [[], []]) for c in mapping.keys()]) | |
for r_ca, m_ca, is_outlier in zip(r_atoms, m_atoms, outliers): | |
r_chain = r_ca.parent.parent.id | |
if is_outlier: | |
distance = 0 | |
else: | |
distance = r_ca - m_ca | |
rms_info[r_chain][0].append(distance) | |
rms_info[r_chain][1].append(is_outlier) | |
for r_chain in rms_info: | |
chain_distances, c_outliers = rms_info[r_chain] | |
n_residues = len(chain_distances) - sum(c_outliers) | |
rms = sum(map(lambda x: x**2, chain_distances)) / n_residues | |
rms = rms**0.5 | |
markers = ''.join(['*' if o else ' ' for o in c_outliers]) | |
rms_info[r_chain] = (rms, n_residues, markers) | |
return (mobile, rms_info) | |
def print_summary(reference, mobile, mapping, rmsd_info): | |
""" | |
""" | |
for ref_chain in reference.get_chains(): | |
r_id = ref_chain.id | |
if r_id in mapping: | |
mc_id, seq_id, gap_id, aln, res_map = mapping[r_id] | |
c_len = len(res_map) | |
chain_rms, n_res, markers = rmsd_info[r_id] | |
_vals = (r_id, mc_id, seq_id, gap_id, chain_rms, n_res, c_len) | |
print('[++] {0}<>{1} := {2:5.1f}% | {3:5.1f}% | {4:5.2f}A ({5}/{6})'.format(*_vals)) | |
print('\t{0[2]}\n\t{0[0]}\n\t{0[1]}\n\t{1}'.format(aln, markers)) | |
else: | |
print('[++] {0}<>None := No Match'.format(r_id)) | |
def save_mobile(reference, mobile): | |
# Write matched/fit file | |
io.set_structure(mobile) | |
match_name = '{0}_matched_to_{1}.pdb'.format(mobile.id, reference.id) | |
print('[==] Saved {0}'.format(match_name)) | |
io.save(match_name) | |
# | |
if __name__ == '__main__': | |
import argparse | |
from argparse import RawTextHelpFormatter | |
ap = argparse.ArgumentParser(description=__doc__.format(__author__, __email__), formatter_class=RawTextHelpFormatter) | |
ap.add_argument('pdbf_list', type=str, nargs='+', help='PDB files') | |
ap.add_argument('--reference', type=str, help='Reference PDB file for comparison') | |
cmd = ap.parse_args() | |
# Bio.PDB classes | |
parser = PDBParser(QUIET=1) | |
io = PDBIO() | |
super_imposer = Superimposer() | |
# The Real Stuff | |
# Read reference first | |
refe_path = cmd.reference if cmd.reference else cmd.pdbf_list[0] | |
print('[+] Matching structures to {0}'.format(refe_path)) | |
reference = parse_structure(refe_path) | |
# Iterate over others | |
for pdbf in cmd.pdbf_list: | |
mobile = parse_structure(pdbf) | |
print('[+] Comparing structures: {0} vs {1}'.format(reference.id, mobile.id)) | |
chain_mapping = match_chains(reference, mobile) | |
matched_mobile, rmsd_info = match_structures(reference, mobile, chain_mapping) | |
mobile = matched_mobile | |
print_summary(reference, mobile, chain_mapping, rmsd_info) | |
save_mobile(reference, mobile) |
Sign up for free
to join this conversation on GitHub.
Already have an account?
Sign in to comment
Great script!