Last active
August 29, 2015 13:57
-
-
Save alexmasselot/9399500 to your computer and use it in GitHub Desktop.
pViz.js custom display example
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| <html> | |
| <head> | |
| <title>pViz.js custom display example</title> | |
| <link rel="stylesheet" href="//netdna.bootstrapcdn.com/bootstrap/3.1.1/css/bootstrap.min.css"> | |
| <link rel="stylesheet" type="text/css" href="http://research-pub.gene.com/pviz/examples/deps/pviz-core.css"> | |
| <script src="http://research-pub.gene.com/pviz/examples/deps/pviz-bundle.min.js"></script> | |
| <style type="text/css" media="screen" clas="example"> | |
| circle.ptms.mickey { | |
| fill: red; | |
| fill-opacity: 0.6; | |
| } | |
| circle.ptms.mickey.doubtful { | |
| fill: blue; | |
| } | |
| </style> | |
| </head> | |
| <body class="container"> | |
| <div class="row"> | |
| <h2>pViz custom display with SVG example</h2> | |
| </div> | |
| <!-- min-width is for http://bl.ocks.org/ iframe (doc width sometimes 0 at init time)--> | |
| <div id="main" class="row" style="min-width:720px"></div> | |
| <div class="row"> | |
| <h3>Comments</h3> | |
| Instead of displaying features as basic, we show here how we can attach some drawing function to some feature type. | |
| <br/> | |
| We pretend we have some fictious ptm's, with a count attribute. We add an 'improbable' atribute to some cases. | |
| This attribute will be used to modifiy the element class, thus its color via css | |
| <br/> | |
| Depending on the type, a svg primitive is called for display and the count attribute used for scaling. | |
| <br/> | |
| The secondary structures are already displayed by 'fancy' ideograms by default | |
| </div> | |
| <div class="row"> | |
| <h4>Way more examples and demo apps with pViz <a href="http://research-pub.gene.com/pviz/examples/" target="_TOP_">here</a></h4> | |
| </div> | |
| <script class="example"> | |
| var pviz = this.pviz; | |
| var seq = 'MELAALCRWGLLLALLPPGAASTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNYALAVLDNGDPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLA'; | |
| var seqEntry = new pviz.SeqEntry({ | |
| sequence : seq | |
| }); | |
| new pviz.SeqEntryAnnotInteractiveView({ | |
| model : seqEntry, | |
| el : '#main' | |
| }).render(); | |
| /** | |
| * setting custome handler for a given type is stringly coupled with d3.js | |
| * two components: | |
| * - appender: to build the widget structure | |
| * - positioner: called at zooming, to adapt position, size (or whatever indeed) | |
| * - color and transparency are defined by css, found in the html header | |
| */ | |
| pviz.FeatureDisplayer.setCustomHandler('mickey', { | |
| appender : function(viewport, svgGroup, features, type) { | |
| var selCircle = svgGroup.selectAll("g.feature.internal.data." + type).data(features).enter().append("g").attr("class", "feature internal data " + type) | |
| selCircle.append("circle").attr('class', 'ptms mickey') | |
| //add a 'doubltful class based on the feature 'improbable' attribute | |
| .classed('doubtful', function(ft) { | |
| return ft.improbable | |
| }).attr('r', function(ft) { | |
| return 4 * Math.sqrt(ft.count) | |
| }); | |
| return selCircle; | |
| }, | |
| positioner : function(viewport, d3selection) { | |
| d3selection.attr('transform', function(ft, i) { | |
| return 'translate(' + viewport.scales.x(ft.start) + ',' + viewport.scales.y(0.5 + ft.displayTrack) + ')'; | |
| }); | |
| return d3selection | |
| } | |
| }); | |
| seqEntry.addFeatures([{ | |
| category : 'ptms', | |
| type : 'mickey', | |
| start : 20, | |
| end : 20, | |
| count : 10 | |
| }, { | |
| category : 'ptms', | |
| type : 'mickey', | |
| start : 22, | |
| end : 22, | |
| count : 3 | |
| }, { | |
| category : 'ptms', | |
| type : 'mickey', | |
| start : 40, | |
| end : 40, | |
| count : 10, | |
| improbable : true //!! an option attribute | |
| }, { | |
| category : 'ptms', | |
| type : 'mickey', | |
| start : 50, | |
| end : 50, | |
| count : 2 | |
| }, { | |
| category : 'regions', | |
| type : 'topological domain', | |
| text : 'extra cellular', | |
| start : 22, | |
| end : 650 | |
| }, { | |
| category : 'secondary structure', | |
| type : 'beta_strand', | |
| start : 24, | |
| end : 26 | |
| }, { | |
| category : 'secondary structure', | |
| type : 'helix', | |
| start : 38, | |
| end : 49 | |
| }, { | |
| category : 'secondary structure', | |
| type : 'beta_strand', | |
| start : 53, | |
| end : 57 | |
| }, { | |
| category : 'secondary structure', | |
| type : 'beta_strand', | |
| start : 59, | |
| end : 63 | |
| }, { | |
| category : 'secondary structure', | |
| type : 'helix', | |
| start : 71, | |
| end : 73 | |
| }, { | |
| category : 'secondary structure', | |
| type : 'beta_strand', | |
| start : 78, | |
| end : 81 | |
| }, { | |
| category : 'secondary structure', | |
| type : 'beta_strand', | |
| start : 83, | |
| end : 87 | |
| }, { | |
| category : 'secondary structure', | |
| type : 'beta_strand', | |
| start : 91, | |
| end : 94 | |
| }, { | |
| category : 'secondary structure', | |
| type : 'turn', | |
| start : 108, | |
| end : 110 | |
| }, { | |
| category : 'secondary structure', | |
| type : 'beta_strand', | |
| start : 111, | |
| end : 116 | |
| }, { | |
| category : 'secondary structure', | |
| type : 'turn', | |
| start : 129, | |
| end : 131 | |
| }, { | |
| category : 'secondary structure', | |
| type : 'beta_strand', | |
| start : 138, | |
| end : 140 | |
| }, { | |
| category : 'secondary structure', | |
| type : 'beta_strand', | |
| start : 150, | |
| end : 155 | |
| }]); | |
| </script> | |
| </body> | |
| </html> |
Sign up for free
to join this conversation on GitHub.
Already have an account?
Sign in to comment