Skip to content

Instantly share code, notes, and snippets.

@boraseoksoon
Last active May 11, 2023 12:26
Show Gist options
  • Save boraseoksoon/a1b19c5a587df1f793eb39d97b7024af to your computer and use it in GitHub Desktop.
Save boraseoksoon/a1b19c5a587df1f793eb39d97b7024af to your computer and use it in GitHub Desktop.
Swift fuzzy search in SwiftUI
This file has been truncated, but you can view the full file.
// written by https://talk.objc.io/episodes/S01E211-simple-fuzzy-matching
// credits should go to obj.io
import SwiftUI
import Cocoa
struct ContentView: View {
@State var needle: String = ""
var filtered: [(string: String, indices: [String.Index])] {
return files.compactMap {
guard let match = $0.fuzzyMatch(needle) else { return nil }
return ($0, match)
}
}
var body: some View {
VStack(spacing: 0) {
HStack(spacing: 0) {
Image(nsImage: search)
.padding(.leading, 10)
TextField("", text: $needle).textFieldStyle(PlainTextFieldStyle())
.padding(10)
.font(.subheadline)
Button(action: {
self.needle = ""
}, label: {
Image(nsImage: close)
.padding()
}).disabled(needle.isEmpty)
.buttonStyle(BorderlessButtonStyle())
}
List(filtered.prefix(30), id: \.string) { result in
highlight(string: result.string, indices: result.indices)
}
}
}
}
func highlight(string: String, indices: [String.Index]) -> Text {
var result = Text("")
for i in string.indices {
let char = Text(String(string[i]))
if indices.contains(i) {
result = result + char.bold()
} else {
result = result + char.foregroundColor(.secondary)
}
}
return result
}
extension String {
func fuzzyMatch(_ needle: String) -> [String.Index]? {
var ixs: [Index] = []
if needle.isEmpty { return [] }
var remainder = needle[...].utf8
for idx in utf8.indices {
let char = utf8[idx]
if char == remainder[remainder.startIndex] {
ixs.append(idx)
remainder.removeFirst()
if remainder.isEmpty { return ixs }
}
}
return nil
}
}
let close = NSImage(named: "NSStopProgressFreestandingTemplate")!
let search = NSImage(named: "NSTouchBarSearchTemplate")!
let files = """
./benchmark
./benchmark/CMakeLists.txt
./benchmark/cmake
./benchmark/cmake/modules
./benchmark/cmake/modules/SwiftBenchmarkUtils.cmake
./benchmark/cmake/modules/AddSwiftBenchmarkSuite.cmake
./benchmark/utils
./benchmark/utils/TestsUtils.swift
./benchmark/utils/DriverUtils.swift
./benchmark/utils/ArgParse.swift
./benchmark/utils/main.swift
./benchmark/utils/ObjectiveCTests
./benchmark/utils/ObjectiveCTests/ObjectiveCTests.h
./benchmark/utils/ObjectiveCTests/ObjectiveCTests.m
./benchmark/utils/ObjectiveCTests/module.modulemap
./benchmark/utils/convertToJSON.py
./benchmark/utils/LibProc
./benchmark/utils/LibProc/LibProcIncludeSystemHeader.h
./benchmark/utils/LibProc/module.modulemap
./benchmark/README.md
./benchmark/single-source
./benchmark/single-source/ObserverPartiallyAppliedMethod.swift
./benchmark/single-source/DiffingMyers.swift
./benchmark/single-source/DictTest.swift
./benchmark/single-source/Exclusivity.swift
./benchmark/single-source/DropLast.swift
./benchmark/single-source/StrComplexWalk.swift
./benchmark/single-source/FindStringNaive.swift
./benchmark/single-source/ReduceInto.swift
./benchmark/single-source/ArrayOfRef.swift
./benchmark/single-source/ClassArrayGetter.swift
./benchmark/single-source/NibbleSort.swift
./benchmark/single-source/PrefixWhile.swift
./benchmark/single-source/Fibonacci.swift
./benchmark/single-source/Calculator.swift
./benchmark/single-source/Diffing.swift
./benchmark/single-source/PopFrontGeneric.swift
./benchmark/single-source/StringRemoveDupes.swift
./benchmark/single-source/ExistentialPerformance.swift.gyb
./benchmark/single-source/Hash.swift
./benchmark/single-source/DictionaryCopy.swift
./benchmark/single-source/BucketSort.swift
./benchmark/single-source/ArrayOfGenericRef.swift
./benchmark/single-source/OpenClose.swift
./benchmark/single-source/StringEdits.swift
./benchmark/single-source/CharacterProperties.swift.gyb
./benchmark/single-source/FloatingPointPrinting.swift
./benchmark/single-source/StringWalk.swift.gyb
./benchmark/single-source/IntegerParsing.swift
./benchmark/single-source/ObserverClosure.swift
./benchmark/single-source/ObjectAllocation.swift
./benchmark/single-source/RangeIteration.swift
./benchmark/single-source/InsertCharacter.swift
./benchmark/single-source/Prefix.swift.gyb
./benchmark/single-source/RemoveWhere.swift
./benchmark/single-source/MapReduce.swift
./benchmark/single-source/SortLettersInPlace.swift
./benchmark/single-source/XorLoop.swift
./benchmark/single-source/ArrayOfPOD.swift
./benchmark/single-source/ObserverForwarderStruct.swift
./benchmark/single-source/SuperChars.swift
./benchmark/single-source/ProtocolDispatch.swift
./benchmark/single-source/NIOChannelPipeline.swift
./benchmark/single-source/CString.swift
./benchmark/single-source/Join.swift
./benchmark/single-source/CaptureProp.swift
./benchmark/single-source/ReversedCollections.swift
./benchmark/single-source/StringTests.swift
./benchmark/single-source/DictionaryKeysContains.swift
./benchmark/single-source/Sim2DArray.swift
./benchmark/single-source/PrimsNonStrongRef.swift
./benchmark/single-source/ArrayOfGenericPOD.swift
./benchmark/single-source/ObjectiveCBridgingStubs.swift
./benchmark/single-source/ExistentialPerformance.swift
./benchmark/single-source/SetTests.swift
./benchmark/single-source/Integrate.swift
./benchmark/single-source/DictionaryOfAnyHashableStrings.swift
./benchmark/single-source/ArrayLiteral.swift
./benchmark/single-source/StringReplaceSubrange.swift
./benchmark/single-source/DictTest3.swift
./benchmark/single-source/DictionaryRemove.swift
./benchmark/single-source/DropLast.swift.gyb
./benchmark/single-source/PointerArithmetics.swift
./benchmark/single-source/LazyFilter.swift
./benchmark/single-source/TwoSum.swift
./benchmark/single-source/RangeReplaceableCollectionPlusDefault.swift
./benchmark/single-source/ArraySetElement.swift
./benchmark/single-source/RandomValues.swift
./benchmark/single-source/SortStrings.swift
./benchmark/single-source/BinaryFloatingPointProperties.swift
./benchmark/single-source/DictionarySubscriptDefault.swift
./benchmark/single-source/DictTest4.swift
./benchmark/single-source/DictionarySwap.swift
./benchmark/single-source/Walsh.swift
./benchmark/single-source/Phonebook.swift
./benchmark/single-source/Histogram.swift
./benchmark/single-source/DropFirst.swift.gyb
./benchmark/single-source/SortLargeExistentials.swift
./benchmark/single-source/RangeOverlaps.swift
./benchmark/single-source/RecursiveOwnedParameter.swift
./benchmark/single-source/StringInterpolation.swift
./benchmark/single-source/StringComparison.swift
./benchmark/single-source/MonteCarloE.swift
./benchmark/single-source/ObjectiveCBridging.swift
./benchmark/single-source/UTF8Decode.swift
./benchmark/single-source/NSDictionaryCastToSwift.swift
./benchmark/single-source/DictTest2.swift
./benchmark/single-source/CharacterLiteralsSmall.swift
./benchmark/single-source/DictionaryBridge.swift
./benchmark/single-source/RGBHistogram.swift
./benchmark/single-source/ChainedFilterMap.swift
./benchmark/single-source/RandomTree.swift
./benchmark/single-source/FloatingPointParsing.swift
./benchmark/single-source/Ackermann.swift
./benchmark/single-source/SortIntPyramids.swift
./benchmark/single-source/SequenceAlgos.swift
./benchmark/single-source/SortArrayInClass.swift
./benchmark/single-source/Hanoi.swift
./benchmark/single-source/Substring.swift
./benchmark/single-source/RangeAssignment.swift
./benchmark/single-source/StringMatch.swift
./benchmark/single-source/RandomShuffle.swift
./benchmark/single-source/TypeFlood.swift
./benchmark/single-source/StaticArray.swift
./benchmark/single-source/ChaCha.swift
./benchmark/single-source/WordCount.swift
./benchmark/single-source/LuhnAlgoLazy.swift
./benchmark/single-source/SevenBoom.swift
./benchmark/single-source/Codable.swift
./benchmark/single-source/DeadArray.swift
./benchmark/single-source/DictionaryCompactMapValues.swift
./benchmark/single-source/COWTree.swift
./benchmark/single-source/MonteCarloPi.swift
./benchmark/single-source/AnyHashableWithAClass.swift
./benchmark/single-source/ProtocolDispatch2.swift
./benchmark/single-source/ArrayInClass.swift
./benchmark/single-source/Memset.swift
./benchmark/single-source/CharacterLiteralsLarge.swift
./benchmark/single-source/StringBuilder.swift
./benchmark/single-source/StringEnum.swift
./benchmark/single-source/OpaqueConsumingUsers.swift
./benchmark/single-source/Suffix.swift
./benchmark/single-source/Suffix.swift.gyb
./benchmark/single-source/COWArrayGuaranteedParameterOverhead.swift
./benchmark/single-source/ErrorHandling.swift
./benchmark/single-source/ArraySubscript.swift
./benchmark/single-source/PrefixWhile.swift.gyb
./benchmark/single-source/Array2D.swift
./benchmark/single-source/BinaryFloatingPointConversionFromBinaryInteger.swift
./benchmark/single-source/PopFront.swift
./benchmark/single-source/CSVParsing.swift
./benchmark/single-source/DictionaryBridgeToObjC.swift
./benchmark/single-source/HTTP2StateMachine.swift
./benchmark/single-source/Prefix.swift
./benchmark/single-source/Mirror.swift
./benchmark/single-source/Queue.swift
./benchmark/single-source/DictOfArraysToArrayOfDicts.swift
./benchmark/single-source/DictionaryGroup.swift
./benchmark/single-source/Breadcrumbs.swift
./benchmark/single-source/ObjectiveCNoBridgingStubs.swift
./benchmark/single-source/RC4.swift
./benchmark/single-source/StackPromo.swift
./benchmark/single-source/AngryPhonebook.swift
./benchmark/single-source/ObserverUnappliedMethod.swift
./benchmark/single-source/ByteSwap.swift
./benchmark/single-source/CharacterProperties.swift
./benchmark/single-source/DictTest4Legacy.swift
./benchmark/single-source/DropWhile.swift
./benchmark/single-source/BitCount.swift
./benchmark/single-source/DataBenchmarks.swift
./benchmark/single-source/ArrayAppend.swift
./benchmark/single-source/DictionaryLiteral.swift
./benchmark/single-source/StringWalk.swift
./benchmark/single-source/Prims.swift
./benchmark/single-source/IterateData.swift
./benchmark/single-source/LuhnAlgoEager.swift
./benchmark/single-source/NSStringConversion.swift
./benchmark/single-source/DropWhile.swift.gyb
./benchmark/single-source/StringComparison.swift.gyb
./benchmark/single-source/StrToInt.swift
./benchmark/single-source/FlattenList.swift
./benchmark/single-source/Radix2CooleyTukey.swift
./benchmark/single-source/DevirtualizeProtocolComposition.swift
./benchmark/single-source/RomanNumbers.swift
./benchmark/single-source/NSError.swift
./benchmark/single-source/Combos.swift
./benchmark/single-source/LinkedList.swift
./benchmark/single-source/NopDeinit.swift
./benchmark/single-source/Chars.swift
./benchmark/single-source/DropFirst.swift
./benchmark/single-source/PolymorphicCalls.swift
./benchmark/scripts
./benchmark/scripts/test_utils.py
./benchmark/scripts/create_benchmark.py
./benchmark/scripts/CMakeLists.txt
./benchmark/scripts/compare_perf_tests.py
./benchmark/scripts/Benchmark_Driver
./benchmark/scripts/run_smoke_bench
./benchmark/scripts/Benchmark_QuickCheck.in
./benchmark/scripts/Template.swift
./benchmark/scripts/Benchmark_DTrace.in
./benchmark/scripts/perf_test_driver
./benchmark/scripts/perf_test_driver/swift_stats.d
./benchmark/scripts/perf_test_driver/perf_test_driver.py
./benchmark/scripts/Benchmark_GuardMalloc.in
./benchmark/scripts/test_Benchmark_Driver.py
./benchmark/scripts/build_script_helper.py
./benchmark/scripts/build_linux.py
./benchmark/scripts/generate_harness
./benchmark/scripts/generate_harness/generate_harness.py
./benchmark/scripts/generate_harness/test_generate_harness.sh
./benchmark/scripts/test_compare_perf_tests.py
./benchmark/scripts/Benchmark_RuntimeLeaksRunner.in
./benchmark/Package.swift
./benchmark/Naming.md
./benchmark/multi-source
./benchmark/multi-source/PrimsSplit
./benchmark/multi-source/PrimsSplit/Prims_main.swift
./benchmark/multi-source/PrimsSplit/README.md
./benchmark/multi-source/PrimsSplit/Prims.swift
./CODE_OF_CONDUCT.md
./.flake8
./.dir-locals.el
./validation-test
./validation-test/benchmark
./validation-test/benchmark/generate-harness.test-sh
./validation-test/benchmark/run-benchmarks.test-sh
./validation-test/IDE
./validation-test/IDE/slow
./validation-test/IDE/slow/rdar45511835.swift
./validation-test/IDE/crashers_fixed
./validation-test/IDE/crashers_fixed/063-swift-generictypeparamtype-get.swift
./validation-test/IDE/crashers_fixed/109-swift-constraints-constraintgraph-change-addedtypevariable.swift
./validation-test/IDE/crashers_fixed/103-swift-constraints-solution-resolvelocatortodecl.swift
./validation-test/IDE/crashers_fixed/023-swift-archetypebuilder-addgenericparameter.swift
./validation-test/IDE/crashers_fixed/040-swift-typechecker-typecheckconstructorbodyuntil.swift
./validation-test/IDE/crashers_fixed/096-swift-genericsignature-getarchetypebuilder.swift
./validation-test/IDE/crashers_fixed/090-swift-iterativetypechecker-satisfy.swift
./validation-test/IDE/crashers_fixed/078-swift-iterativetypechecker-processtypechecksuperclass.swift
./validation-test/IDE/crashers_fixed/070-swift-archetypebuilder-maptypeintocontext.swift
./validation-test/IDE/crashers_fixed/017-swift-expr-walk.swift
./validation-test/IDE/crashers_fixed/043-swift-boundgenerictype-getsubstitutions.swift
./validation-test/IDE/crashers_fixed/088-swift-typechecker-performtypocorrection.swift
./validation-test/IDE/crashers_fixed/028-swift-typechecker-validategenericsignature.swift
./validation-test/IDE/crashers_fixed/005-swift-typechecker-gettypeofexpressionwithoutapplying.swift
./validation-test/IDE/crashers_fixed/092-swift-genericenvironment-genericenvironment.swift
./validation-test/IDE/crashers_fixed/091-swift-typechecker-computedefaultaccessibility.swift
./validation-test/IDE/crashers_fixed/067-swift-constraints-constraintsystem-resolveoverload.swift
./validation-test/IDE/crashers_fixed/020-swift-typechecker-validategenericfuncsignature.swift
./validation-test/IDE/crashers_fixed/037-swift-typechecker-resolvetypeincontext.swift
./validation-test/IDE/crashers_fixed/058-swift-constraints-constraintsystem-diagnosefailureforexpr.swift
./validation-test/IDE/crashers_fixed/014-swift-parser-parsedeclvar.swift
./validation-test/IDE/crashers_fixed/106-swift-moduledecl-lookupconformance.swift
./validation-test/IDE/crashers_fixed/105-swift-derivedconformance-deriverawrepresentable.swift
./validation-test/IDE/crashers_fixed/extension-protocol-composition.swift
./validation-test/IDE/crashers_fixed/009-swift-performdelayedparsing.swift
./validation-test/IDE/crashers_fixed/081-swift-genericsignature-getsubstitutionmap.swift
./validation-test/IDE/crashers_fixed/subexpr-literal-in-sequence-expr.swift
./validation-test/IDE/crashers_fixed/084-swift-parser-consumedecl.swift
./validation-test/IDE/crashers_fixed/057-swift-valuedecl-settype.swift
./validation-test/IDE/crashers_fixed/071-swift-printoptions-setarchetypetransform.swift
./validation-test/IDE/crashers_fixed/089-swift-namealiastype-getsinglydesugaredtype.swift
./validation-test/IDE/crashers_fixed/053-swift-typebase-getsuperclass.swift
./validation-test/IDE/crashers_fixed/086-swift-printoptions-setarchetypeanddynamicselftransform.swift
./validation-test/IDE/crashers_fixed/052-swift-mangle-mangler-manglegenericsignatureparts.swift
./validation-test/IDE/crashers_fixed/008-swift-typechecker-typecheckfunctionbodyuntil.swift
./validation-test/IDE/crashers_fixed/085-swift-persistentparserstate-delaytoplevel.swift
./validation-test/IDE/crashers_fixed/104-swift-gettypeofcompletioncontextexpr.swift
./validation-test/IDE/crashers_fixed/012-swift-mangle-mangler-manglecontext.swift
./validation-test/IDE/crashers_fixed/061-swift-constraints-solution-coercetotype.swift
./validation-test/IDE/crashers_fixed/100-swift-mangle-mangler-mangledeclname.swift
./validation-test/IDE/crashers_fixed/054-swift-moduledecl-forallvisiblemodules.swift
./validation-test/IDE/crashers_fixed/046-swift-typechecker-typecheckdecl.swift
./validation-test/IDE/crashers_fixed/rdar50666427.swift
./validation-test/IDE/crashers_fixed/030-swift-mangle-mangler-mangledecltype.swift
./validation-test/IDE/crashers_fixed/075-swift-printoptions-setarchetypeselftransform.swift
./validation-test/IDE/crashers_fixed/068-swift-typechecker-resolvetypewitness.swift
./validation-test/IDE/crashers_fixed/108-swift-typechecker-typecheckcompletionsequence.swift
./validation-test/IDE/crashers_fixed/107-swift-typechecker-typecheckabstractfunctionbodyuntil.swift
./validation-test/IDE/crashers_fixed/033-swift-identifier-isoperatorslow.swift
./validation-test/IDE/crashers_fixed/029-swift-decl-walk.swift
./validation-test/IDE/crashers_fixed/087-swift-declcontext-getparentmodule.swift
./validation-test/IDE/crashers_fixed/069-swift-typechecker-typecheckparameterlist.swift
./validation-test/IDE/crashers_fixed/099-swift-genericenvironment-maptypeintocontext.swift
./validation-test/IDE/crashers_fixed/010-swift-archetypebuilder-addrequirement.swift
./validation-test/IDE/crashers_fixed/026-swift-mangle-mangler-mangletype.swift
./validation-test/IDE/crashers_fixed/049-swift-typechecker-resolvewitness.swift
./validation-test/IDE/crashers_fixed/004-swift-typebase-getmembersubstitutions.swift
./validation-test/IDE/crashers_fixed/assign-anyobject.swift
./validation-test/IDE/crashers_fixed/047-swift-typechecker-typechecktoplevelcodedecl.swift
./validation-test/IDE/crashers_fixed/051-swift-mangle-mangler-mangleassociatedtypename.swift
./validation-test/IDE/crashers_fixed/050-swift-constraints-constraintsystem-matchtypes.swift
./validation-test/IDE/crashers_fixed/074-swift-valuedecl-geteffectiveaccess.swift
./validation-test/IDE/crashers_fixed/056-swift-archetypebuilder-getallarchetypes.swift
./validation-test/IDE/crashers_fixed/011-swift-lookupvisibledecls.swift
./validation-test/IDE/crashers_fixed/062-swift-constraints-solution-computesubstitutions.swift
./validation-test/IDE/crashers_fixed/079-swift-archetypebuilder-maptypeoutofcontext.swift
./validation-test/IDE/crashers_fixed/015-swift-typechecker-lookupunqualified.swift
./validation-test/IDE/crashers_fixed/082-swift-typebase-gatherallsubstitutions.swift
./validation-test/IDE/crashers_fixed/001-swift-ide-removecodecompletiontokens.swift
./validation-test/IDE/crashers_fixed/035-swift-typechecker-validatedecl.swift
./validation-test/IDE/crashers_fixed/041-swift-archetypebuilder-getgenericsignature.swift
./validation-test/IDE/crashers_fixed/095-swift-declcontext-getresilienceexpansion.swift
./validation-test/IDE/crashers_fixed/064-swift-genericfunctiontype-get.swift
./validation-test/IDE/crashers_fixed/036-swift-constraints-constraintsystem-matchdeepequalitytypes.swift
./validation-test/IDE/crashers_fixed/060-swift-constructordecl-getresulttype.swift
./validation-test/IDE/crashers_fixed/077-swift-archetypebuilder-potentialarchetype-gettype.swift
./validation-test/IDE/crashers_fixed/076-swift-typechecker-checkinheritanceclause.swift
./validation-test/IDE/crashers_fixed/094-swift-typechecker-lookupmembertype.swift
./validation-test/IDE/crashers_fixed/016-swift-mangle-mangler-mangleidentifier.swift
./validation-test/IDE/crashers_fixed/072-swift-constraints-constraintsystem-opengeneric.swift
./validation-test/IDE/crashers_fixed/024-swift-archetypebuilder-potentialarchetype-getrepresentative.swift
./validation-test/IDE/crashers_fixed/101-swift-decl-print.swift
./validation-test/IDE/crashers_fixed/018-swift-type-transform.swift
./validation-test/IDE/crashers_fixed/059-swift-iterativetypechecker-processinheritedprotocols.swift
./validation-test/IDE/crashers_fixed/019-swift-vardecl-emitlettovarnoteifsimple.swift
./validation-test/IDE/crashers_fixed/021-swift-typechecker-resolveidentifiertype.swift
./validation-test/IDE/crashers_fixed/080-swift-valuedecl-getinterfacetype.swift
./validation-test/IDE/crashers_fixed/083-swift-declcontext-getgenericparamsofcontext.swift
./validation-test/IDE/crashers_fixed/027-swift-typebase-getdesugaredtype.swift
./validation-test/IDE/crashers_fixed/093-swift-valuedecl-getformalaccessscope.swift
./validation-test/IDE/crashers_fixed/002-swift-diagnosticengine-emitdiagnostic.swift
./validation-test/IDE/crashers_fixed/031-swift-mangle-mangler-manglenominaltype.swift
./validation-test/IDE/crashers_fixed/048-swift-completegenerictyperesolver-resolvedependentmembertype.swift
./validation-test/IDE/crashers_fixed/013-swift-constraints-constraintgraph-addconstraint.swift
./validation-test/IDE/crashers_fixed/098-swift-declcontext-lookupqualified.swift
./validation-test/IDE/crashers_fixed/066-swift-conformancelookuptable-expandimpliedconformances.swift
./validation-test/IDE/crashers_fixed/003-swift-typebase-getcanonicaltype.swift
./validation-test/IDE/crashers_fixed/034-swift-specializedprotocolconformance-gettypewitnesssubstanddecl.swift
./validation-test/IDE/crashers_fixed/032-swift-expr-propagatelvalueaccesskind.swift
./validation-test/IDE/crashers_fixed/102-swift-typechecker-gettypeofrvalue.swift
./validation-test/IDE/crashers_fixed/044-swift-dependentgenerictyperesolver-resolveselfassociatedtype.swift
./validation-test/IDE/crashers_fixed/073-swift-archetypebuilder-enumeraterequirements.swift
./validation-test/IDE/crashers_fixed/055-swift-valuedecl-getoverloadsignature.swift
./validation-test/IDE/crashers_fixed/045-swift-protocoldecl-requiresclassslow.swift
./validation-test/IDE/crashers_fixed/025-swift-mangle-mangler-bindgenericparameters.swift
./validation-test/IDE/crashers_fixed/022-swift-typechecker-applygenericarguments.swift
./validation-test/IDE/crashers_fixed/038-swift-mangle-mangler-getdecltypeformangling.swift
./validation-test/IDE/crashers_fixed/097-swift-archetypebuilder-addgenericsignature.swift
./validation-test/IDE/crashers_fixed/042-swift-typechecker-checkgenericarguments.swift
./validation-test/IDE/crashers_fixed/006-swift-declcontext-getprotocolself.swift
./validation-test/IDE/crashers_fixed/007-swift-configureimplicitself.swift
./validation-test/IDE/crashers_fixed/039-swift-typechecker-checkconformance.swift
./validation-test/IDE/complete_from_cocoa_2.swift
./validation-test/IDE/complete_repl_from_cocoa.swift
./validation-test/IDE/crashers_2_fixed
./validation-test/IDE/crashers_2_fixed/0005-should-have-found-non-type-context-by-now.swift
./validation-test/IDE/crashers_2_fixed/sr8568.swift
./validation-test/IDE/crashers_2_fixed/0012-protocol-where-clause.swift
./validation-test/IDE/crashers_2_fixed/rdar41224316.swift
./validation-test/IDE/crashers_2_fixed/0021-lexer-commentlength.swift
./validation-test/IDE/crashers_2_fixed/0013-unmapped-dependent-type-2.swift
./validation-test/IDE/crashers_2_fixed/0020-rdar42056741.swift
./validation-test/IDE/crashers_2_fixed/sr8471.swift
./validation-test/IDE/crashers_2_fixed/0004-unmapped-dependent-type.swift
./validation-test/IDE/crashers_2_fixed/0006-crazy-associated-types.swift
./validation-test/IDE/crashers_2_fixed/sr9001.swift
./validation-test/IDE/crashers_2_fixed/0024-complete_repl_decl_conformance.swift
./validation-test/IDE/crashers_2_fixed/rdar58470999.swift
./validation-test/IDE/crashers_2_fixed/sr8554.swift
./validation-test/IDE/crashers_2_fixed/0018-rdar38189778.swift
./validation-test/IDE/crashers_2_fixed/0007-archetype-not-in-context.swift
./validation-test/IDE/crashers_2_fixed/0022-rdar42678836.swift
./validation-test/IDE/crashers_2_fixed/rdar42098113.swift
./validation-test/IDE/crashers_2_fixed/0015-pound-if-without-endif.swift
./validation-test/IDE/crashers_2_fixed/rdar43625800.swift
./validation-test/IDE/crashers_2_fixed/0003-complete-default-argument-closure.swift
./validation-test/IDE/crashers_2_fixed/rdar52105899.swift
./validation-test/IDE/crashers_2_fixed/0009-protocol-extension-self-assign.swift
./validation-test/IDE/crashers_2_fixed/0010-reference-to-self-in-extension-init.swift
./validation-test/IDE/crashers_2_fixed/0002-complete-unbound-generic-type.swift
./validation-test/IDE/crashers_2_fixed/rdar56834798.swift
./validation-test/IDE/crashers_2_fixed/rdar42828673.swift
./validation-test/IDE/crashers_2_fixed/rdar48648877.swift
./validation-test/IDE/crashers_2_fixed/0023-rdar41331096.swift
./validation-test/IDE/crashers_2_fixed/0019-rdar39909829.swift
./validation-test/IDE/crashers_2_fixed/0014-sr4560.swift
./validation-test/IDE/crashers_2_fixed/rdar48896424.swift
./validation-test/IDE/crashers_2_fixed/0017-editorplacehoder-at-eof.swift
./validation-test/IDE/crashers_2_fixed/rdar42639255.swift
./validation-test/IDE/crashers_2_fixed/0001-complete-typeloc-in-generic-signature.swift
./validation-test/IDE/crashers_2_fixed/0008-must-conform-to-literal-protocol.swift
./validation-test/IDE/crashers_2_fixed/0016-operator-unresolved-dot.swift
./validation-test/IDE/crashers_2_fixed/0025-complete_repl_extension_where.swift
./validation-test/IDE/crashers_2_fixed/0011-complete-protocol-with-initializer.swift
./validation-test/IDE/complete_from_cocoa.swift
./validation-test/IDE/print_stdlib_specialized.swift
./validation-test/SILOptimizer
./validation-test/SILOptimizer/large_string_array.swift.gyb
./validation-test/SILOptimizer/string_switch.swift
./validation-test/Sanitizers
./validation-test/Sanitizers/tsan-inout.swift
./validation-test/Sanitizers/fuzzer.swift
./validation-test/Sanitizers/witness_table_lookup.swift
./validation-test/Sanitizers/tsan-ignores-arc-locks.swift
./validation-test/Sanitizers/tsan-type-metadata.swift
./validation-test/Sanitizers/Inputs
./validation-test/Sanitizers/Inputs/tsan-uninstrumented.swift
./validation-test/ClangImporter
./validation-test/ClangImporter/macros-repeatedly-redefined.swift
./validation-test/ClangImporter/explicit-system-framework-path.swift
./validation-test/ClangImporter/bridging-header-reentrancy.swift
./validation-test/ClangImporter/Inputs
./validation-test/ClangImporter/Inputs/bridging-header-reentrancy
./validation-test/ClangImporter/Inputs/bridging-header-reentrancy/K.h
./validation-test/ClangImporter/Inputs/bridging-header-reentrancy/A.h
./validation-test/ClangImporter/Inputs/bridging-header-reentrancy/E.h
./validation-test/ClangImporter/Inputs/bridging-header-reentrancy/O.h
./validation-test/ClangImporter/Inputs/bridging-header-reentrancy/Y.h
./validation-test/ClangImporter/Inputs/bridging-header-reentrancy/S.h
./validation-test/ClangImporter/Inputs/bridging-header-reentrancy/W.h
./validation-test/ClangImporter/Inputs/bridging-header-reentrancy/Main-Bridging-Header.h
./validation-test/ClangImporter/Inputs/bridging-header-reentrancy/H.h
./validation-test/ClangImporter/Inputs/bridging-header-reentrancy/B.h
./validation-test/ClangImporter/Inputs/bridging-header-reentrancy/F.h
./validation-test/ClangImporter/Inputs/bridging-header-reentrancy/L.h
./validation-test/ClangImporter/Inputs/bridging-header-reentrancy/Z.h
./validation-test/ClangImporter/Inputs/bridging-header-reentrancy/P.h
./validation-test/ClangImporter/Inputs/bridging-header-reentrancy/T.h
./validation-test/ClangImporter/Inputs/bridging-header-reentrancy/CoincidentalNameCollision.swift
./validation-test/ClangImporter/Inputs/bridging-header-reentrancy/C.h
./validation-test/ClangImporter/Inputs/bridging-header-reentrancy/I.h
./validation-test/ClangImporter/Inputs/bridging-header-reentrancy/CoincidentalNameCollision.h
./validation-test/ClangImporter/Inputs/bridging-header-reentrancy/M.h
./validation-test/ClangImporter/Inputs/bridging-header-reentrancy/G.h
./validation-test/ClangImporter/Inputs/bridging-header-reentrancy/App-Bridging-Header.h
./validation-test/ClangImporter/Inputs/bridging-header-reentrancy/Q.h
./validation-test/ClangImporter/Inputs/bridging-header-reentrancy/U.h
./validation-test/ClangImporter/Inputs/bridging-header-reentrancy/J.h
./validation-test/ClangImporter/Inputs/bridging-header-reentrancy/N.h
./validation-test/ClangImporter/Inputs/bridging-header-reentrancy/module.modulemap
./validation-test/ClangImporter/Inputs/bridging-header-reentrancy/D.h
./validation-test/ClangImporter/Inputs/bridging-header-reentrancy/R.h
./validation-test/ClangImporter/Inputs/bridging-header-reentrancy/X.h
./validation-test/ClangImporter/Inputs/bridging-header-reentrancy/V.h
./validation-test/ClangImporter/Inputs/explicit-system-framework-path
./validation-test/ClangImporter/Inputs/explicit-system-framework-path/override
./validation-test/ClangImporter/Inputs/explicit-system-framework-path/override/Test.framework
./validation-test/ClangImporter/Inputs/explicit-system-framework-path/override/Test.framework/Headers
./validation-test/ClangImporter/Inputs/explicit-system-framework-path/override/Test.framework/Headers/Test.h
./validation-test/ClangImporter/Inputs/explicit-system-framework-path/override/Test.framework/Modules
./validation-test/ClangImporter/Inputs/explicit-system-framework-path/override/Test.framework/Modules/module.modulemap
./validation-test/ClangImporter/Inputs/explicit-system-framework-path/override/TestUser.framework
./validation-test/ClangImporter/Inputs/explicit-system-framework-path/override/TestUser.framework/Headers
./validation-test/ClangImporter/Inputs/explicit-system-framework-path/override/TestUser.framework/Headers/TestUser.h
./validation-test/ClangImporter/Inputs/explicit-system-framework-path/override/TestUser.framework/Modules
./validation-test/ClangImporter/Inputs/explicit-system-framework-path/override/TestUser.framework/Modules/module.modulemap
./validation-test/ClangImporter/Inputs/explicit-system-framework-path/sdkroot
./validation-test/ClangImporter/Inputs/explicit-system-framework-path/sdkroot/Library
./validation-test/ClangImporter/Inputs/explicit-system-framework-path/sdkroot/Library/Frameworks
./validation-test/ClangImporter/Inputs/explicit-system-framework-path/sdkroot/Library/Frameworks/Test.framework
./validation-test/ClangImporter/Inputs/explicit-system-framework-path/sdkroot/Library/Frameworks/Test.framework/Headers
./validation-test/ClangImporter/Inputs/explicit-system-framework-path/sdkroot/Library/Frameworks/Test.framework/Headers/Test.h
./validation-test/ClangImporter/Inputs/explicit-system-framework-path/sdkroot/Library/Frameworks/Test.framework/Modules
./validation-test/ClangImporter/Inputs/explicit-system-framework-path/sdkroot/Library/Frameworks/Test.framework/Modules/module.modulemap
./validation-test/ClangImporter/Inputs/macros-repeatedly-redefined
./validation-test/ClangImporter/Inputs/macros-repeatedly-redefined/A.h
./validation-test/ClangImporter/Inputs/macros-repeatedly-redefined/E.h
./validation-test/ClangImporter/Inputs/macros-repeatedly-redefined/B.h
./validation-test/ClangImporter/Inputs/macros-repeatedly-redefined/F.h
./validation-test/ClangImporter/Inputs/macros-repeatedly-redefined/C.h
./validation-test/ClangImporter/Inputs/macros-repeatedly-redefined/module.modulemap
./validation-test/ClangImporter/Inputs/macros-repeatedly-redefined/D.h
./validation-test/NameBinding
./validation-test/NameBinding/inconsistent-implementation-only-errors.swift
./validation-test/Python
./validation-test/Python/gyb.swift
./validation-test/Python/build_swift.swift
./validation-test/Python/bug-reducer.test-sh
./validation-test/Python/update_checkout.swift
./validation-test/Python/python_lint.swift
./validation-test/Python/swift_build_support.swift
./validation-test/Python/line-directive.swift
./validation-test/Python/cmpcodesize.swift
./validation-test/Driver
./validation-test/Driver/Dependencies
./validation-test/Driver/Dependencies/rdar23148987-type-fingerprints.swift
./validation-test/Driver/Dependencies/rdar23148987.swift
./validation-test/Driver/Dependencies/rdar25405605.swift
./validation-test/Driver/Dependencies/Inputs
./validation-test/Driver/Dependencies/Inputs/rdar23148987
./validation-test/Driver/Dependencies/Inputs/rdar23148987/helper-2.swift
./validation-test/Driver/Dependencies/Inputs/rdar23148987/helper-1.swift
./validation-test/Driver/Dependencies/Inputs/rdar23148987/output.json
./validation-test/Driver/Dependencies/Inputs/rdar25405605
./validation-test/Driver/Dependencies/Inputs/rdar25405605/helper-2.swift
./validation-test/Driver/Dependencies/Inputs/rdar25405605/helper-3.swift
./validation-test/Driver/Dependencies/Inputs/rdar25405605/helper-1.swift
./validation-test/Driver/Dependencies/Inputs/rdar25405605/output.json
./validation-test/Driver/clang_rt.swift
./validation-test/Driver/batch_mode_size_limit.swift
./validation-test/Driver/many-inputs.swift
./validation-test/Driver/Inputs
./validation-test/Driver/Inputs/clang_rt-helper.h
./validation-test/ParseableInterface
./validation-test/ParseableInterface/verify_stdlib.swift
./validation-test/ParseableInterface/verify_simd.swift
./validation-test/ParseableInterface/verify_all_overlays.py
./validation-test/ParseableInterface/failing-overlay.swift
./validation-test/ParseableInterface/lit.local.cfg
./validation-test/ParseableInterface/Inputs
./validation-test/ParseableInterface/Inputs/failing-overlay
./validation-test/ParseableInterface/Inputs/failing-overlay/ImportsOverlay.h
./validation-test/ParseableInterface/Inputs/failing-overlay/HasOverlay.h
./validation-test/ParseableInterface/Inputs/failing-overlay/HasOverlay.swiftinterface
./validation-test/ParseableInterface/Inputs/failing-overlay/module.modulemap
./validation-test/Serialization
./validation-test/Serialization/SR7337.swift
./validation-test/Serialization/crash-superclass-dependency-cycle.swift
./validation-test/Serialization/serialization_loops.swift
./validation-test/Serialization/rdar40899824.swift
./validation-test/Serialization/bridging-header-first.swift
./validation-test/Serialization/Foundation-determinism-wmo.swift
./validation-test/Serialization/SR8045.swift
./validation-test/Serialization/crash-superclass-dependency-removal.swift
./validation-test/Serialization/SR5191.swift
./validation-test/Serialization/rdar40839486.swift
./validation-test/Serialization/SR3915.swift
./validation-test/Serialization/SR4211.swift
./validation-test/Serialization/SR7978.swift
./validation-test/Serialization/rdar29694978.swift
./validation-test/Serialization/SR7879.swift
./validation-test/Serialization/xref-badtag-49336277
./validation-test/Serialization/xref-badtag-49336277/main.swift
./validation-test/Serialization/xref-badtag-49336277/Inputs
./validation-test/Serialization/xref-badtag-49336277/Inputs/itermod.swift
./validation-test/Serialization/xref-badtag-49336277/Inputs/dependmod.swift
./validation-test/Serialization/xref-badtag-49336277/Inputs/basemod.swift
./validation-test/Serialization/Foundation-determinism.swift
./validation-test/Serialization/conformance-removed.swift
./validation-test/Serialization/Inputs
./validation-test/Serialization/Inputs/SR3915-other.swift
./validation-test/Serialization/Inputs/serialization_loops.h
./validation-test/Serialization/Inputs/SR8045-other.swift
./validation-test/Serialization/Inputs/rdar29694978.h
./validation-test/Serialization/Inputs/serialization_loops_helper2.swift
./validation-test/Serialization/Inputs/custom-modules
./validation-test/Serialization/Inputs/custom-modules/rdar40899824Helper.h
./validation-test/Serialization/Inputs/custom-modules/SuperclassObjC.h
./validation-test/Serialization/Inputs/custom-modules/module.modulemap
./validation-test/Serialization/Inputs/serialization_loops_helper.swift
./validation-test/Serialization/Inputs/bridging-header-first
./validation-test/Serialization/Inputs/bridging-header-first/AmbivalentProtocol.h
./validation-test/Serialization/Inputs/bridging-header-first/bridging.h
./validation-test/Serialization/Inputs/bridging-header-first/Module
./validation-test/Serialization/Inputs/bridging-header-first/Module/modular.h
./validation-test/Serialization/Inputs/bridging-header-first/Module/module.modulemap
./validation-test/Serialization/Inputs/conformance-removed
./validation-test/Serialization/Inputs/conformance-removed/ObjCLib.h
./validation-test/Serialization/Inputs/conformance-removed/SwiftLib.swift
./validation-test/Serialization/Inputs/conformance-removed/module.modulemap
./validation-test/Serialization/Inputs/SR5191-other.swift
./validation-test/BuildSystem
./validation-test/BuildSystem/skip-local-build.test-sh
./validation-test/BuildSystem/install_all.test
./validation-test/BuildSystem/infer_dumps_deps_if_verbose_build.test
./validation-test/BuildSystem/LTO
./validation-test/BuildSystem/LTO/object-files-do-have-bitcode.test-sh
./validation-test/BuildSystem/LTO/target-libraries-do-not-have-bitcode.test-sh
./validation-test/BuildSystem/LTO/lto-object-files-only-have-line-tables.test-sh
./validation-test/BuildSystem/LTO/host-libraries-do-have-bitcode.test-sh
./validation-test/BuildSystem/install_all_linux.test
./validation-test/BuildSystem/infer_implies_install_all.test
./validation-test/BuildSystem/skip_cmark_swift_llvm.test
./validation-test/Runtime
./validation-test/Runtime/old_runtime_crash_without_fixed_layout.swift
./validation-test/Runtime/weak-reference-racetests.swift
./validation-test/Runtime/class_stubs.m
./validation-test/Runtime/class_stubs_weak.m
./validation-test/Runtime/class_update_callback_without_fixed_layout.m
./validation-test/Runtime/class_update_callback_with_fixed_layout.m
./validation-test/Runtime/sr8666.swift
./validation-test/Runtime/ExclusivityTest.swift
./validation-test/Runtime/weak-reference-racetests-dispatch.swift
./validation-test/Runtime/Inputs
./validation-test/Runtime/Inputs/class-stubs-weak
./validation-test/Runtime/Inputs/class-stubs-weak/second.swift
./validation-test/Runtime/Inputs/class-stubs-weak/first.swift
./validation-test/Runtime/Inputs/class-stubs-weak/module.map
./validation-test/Runtime/Inputs/class-stubs-from-objc
./validation-test/Runtime/Inputs/class-stubs-from-objc/second.swift
./validation-test/Runtime/Inputs/class-stubs-from-objc/first.swift
./validation-test/Runtime/Inputs/class-stubs-from-objc/module.map
./validation-test/Runtime/Inputs/class-layout-from-objc
./validation-test/Runtime/Inputs/class-layout-from-objc/small.yaml
./validation-test/Runtime/Inputs/class-layout-from-objc/Classes.swift
./validation-test/Runtime/Inputs/class-layout-from-objc/big.yaml
./validation-test/Runtime/Inputs/class-layout-from-objc/OneWordSuperclass.m
./validation-test/Runtime/Inputs/class-layout-from-objc/Resilient.swift
./validation-test/Runtime/Inputs/class-layout-from-objc/module.modulemap
./validation-test/Runtime/Inputs/class-layout-from-objc/OneWordSuperclass.h
./validation-test/compiler_crashers
./validation-test/compiler_crashers/28806-swift-silmodule-get-or-create-function.swift
./validation-test/compiler_crashers/28870-swift-associatedtypedecl-getoverriddendecls-const.swift
./validation-test/compiler_crashers/28510-size-t-llvm-sys-locale-columnwidth-i-gettext-i-gettext-size.swift
./validation-test/compiler_crashers/28809-isdigit-ident-pos-first-char-of-sub-string-may-not-be-a-digit.swift
./validation-test/compiler_crashers/28782-superclass-superclass-isequal-t-should-have-diagnosed-multiple-superclasses-by-n.swift
./validation-test/compiler_crashers/README
./validation-test/compiler_crashers/lit.local.cfg
./validation-test/IRGen
./validation-test/IRGen/sr6844.swift
./validation-test/IRGen/Inputs
./validation-test/IRGen/Inputs/sr6844.h
./validation-test/Sema
./validation-test/Sema/type_checker_crashers_fixed
./validation-test/Sema/type_checker_crashers_fixed/rdar45470505.swift
./validation-test/Sema/type_checker_crashers_fixed/rdar27787341.swift
./validation-test/Sema/type_checker_crashers_fixed/sr2635.swift
./validation-test/Sema/type_checker_crashers_fixed/rdar28317710.swift
./validation-test/Sema/type_checker_crashers_fixed/rdar28221883.swift
./validation-test/Sema/type_checker_crashers_fixed/rdar28048391.swift
./validation-test/Sema/type_checker_crashers_fixed/rdar28235248.swift
./validation-test/Sema/type_checker_crashers_fixed/rdar47266563.swift
./validation-test/Sema/type_checker_crashers_fixed/rdar27575060.swift
./validation-test/Sema/type_checker_crashers_fixed/rdar27261929.swift
./validation-test/Sema/type_checker_crashers_fixed/rdar50666427.swift
./validation-test/Sema/type_checker_crashers_fixed/rdar48994658.swift
./validation-test/Sema/type_checker_crashers_fixed/rdar28619118.swift
./validation-test/Sema/type_checker_crashers_fixed/rdar29075927.swift
./validation-test/Sema/type_checker_crashers_fixed/rdar51576862.swift
./validation-test/Sema/type_checker_crashers_fixed/rdar27464577.swift
./validation-test/Sema/type_checker_crashers_fixed/rdar28023899.swift
./validation-test/Sema/type_checker_crashers_fixed/rdar27329076.swift
./validation-test/Sema/type_checker_crashers_fixed/rdar27879334.swift
./validation-test/Sema/type_checker_crashers_fixed/sr1512.swift
./validation-test/Sema/type_checker_crashers_fixed/rdar27815848.swift
./validation-test/Sema/type_checker_crashers_fixed/rdar27148148.swift
./validation-test/Sema/type_checker_crashers_fixed/overloaded_generic.swift
./validation-test/Sema/type_checker_crashers_fixed/rdar19343997.swift
./validation-test/Sema/type_checker_crashers_fixed/sr1902.swift
./validation-test/Sema/type_checker_crashers_fixed/rdar27249691.swift
./validation-test/Sema/type_checker_crashers_fixed/rdar20771765.swift
./validation-test/Sema/type_checker_crashers_fixed/rdar27830834.swift
./validation-test/Sema/type_checker_crashers_fixed/rdar27017206.swift
./validation-test/Sema/type_checker_crashers_fixed/rdar28145033.swift
./validation-test/Sema/type_checker_crashers_fixed/rdar50869732.swift
./validation-test/Sema/type_checker_crashers_fixed/rdar49712364.swift
./validation-test/Sema/type_checker_perf
./validation-test/Sema/type_checker_perf/slow
./validation-test/Sema/type_checker_perf/slow/rdar23327871.swift.gyb
./validation-test/Sema/type_checker_perf/slow/rdar27585838.swift.gyb
./validation-test/Sema/type_checker_perf/slow/rdar23861629.swift
./validation-test/Sema/type_checker_perf/slow/rdar32034560.swift
./validation-test/Sema/type_checker_perf/slow/nil_coalescing.swift.gyb
./validation-test/Sema/type_checker_perf/slow/rdar30596744_2.swift.gyb
./validation-test/Sema/type_checker_perf/slow/rdar19915443.swift
./validation-test/Sema/type_checker_perf/slow/rdar23682605.swift
./validation-test/Sema/type_checker_perf/slow/rdar19737632.swift
./validation-test/Sema/type_checker_perf/slow/rdar46713933.swift
./validation-test/Sema/type_checker_perf/slow/rdar30606089.swift.gyb
./validation-test/Sema/type_checker_perf/slow/rdar26564101.swift
./validation-test/Sema/type_checker_perf/slow/rdar21198787.swift.gyb
./validation-test/Sema/type_checker_perf/slow/rdar30596744_1.swift.gyb
./validation-test/Sema/type_checker_perf/slow/rdar33476240.swift
./validation-test/Sema/type_checker_perf/slow/rdar22949523.swift
./validation-test/Sema/type_checker_perf/slow/rdar22079400.swift
./validation-test/Sema/type_checker_perf/slow/rdar19368383.swift
./validation-test/Sema/type_checker_perf/slow/rdar33688063.swift
./validation-test/Sema/type_checker_perf/slow/rdar20859567.swift
./validation-test/Sema/type_checker_perf/slow/rdar23224583.swift
./validation-test/Sema/type_checker_perf/slow/rdar18994321.swift
./validation-test/Sema/type_checker_perf/slow/rdar19612086.swift
./validation-test/Sema/type_checker_perf/slow/rdar30631148.swift
./validation-test/Sema/type_checker_perf/slow/rdar18800950.swift
./validation-test/Sema/type_checker_perf/slow/rdar33289839.swift.gyb
./validation-test/Sema/type_checker_perf/slow/rdar33935430.swift
./validation-test/Sema/type_checker_perf/slow/rdar53589951.swift
./validation-test/Sema/type_checker_perf/slow/rdar22022980.swift
./validation-test/Sema/type_checker_perf/slow/rdar25866240.swift.gyb
./validation-test/Sema/type_checker_perf/slow/rdar22877285.swift
./validation-test/Sema/type_checker_perf/fast
./validation-test/Sema/type_checker_perf/fast/rdar22810685.swift.gyb
./validation-test/Sema/type_checker_perf/fast/rdar22466245.swift
./validation-test/Sema/type_checker_perf/fast/rdar18699199.swift.gyb
./validation-test/Sema/type_checker_perf/fast/simd_add.gyb
./validation-test/Sema/type_checker_perf/fast/rdar36838495.swift
./validation-test/Sema/type_checker_perf/fast/array_of_tuples.swift.gyb
./validation-test/Sema/type_checker_perf/fast/rdar20233198_weak.swift.gyb
./validation-test/Sema/type_checker_perf/fast/rdar18522024.swift
./validation-test/Sema/type_checker_perf/fast/rdar60961087.swift.gyb
./validation-test/Sema/type_checker_perf/fast/rdar35213699.swift
./validation-test/Sema/type_checker_perf/fast/rdar21070413.swift.gyb
./validation-test/Sema/type_checker_perf/fast/rdar18724501.swift.gyb
./validation-test/Sema/type_checker_perf/fast/rdar29025667.swift.gyb
./validation-test/Sema/type_checker_perf/fast/rdar54926602.swift
./validation-test/Sema/type_checker_perf/fast/rdar47492691.swift
./validation-test/Sema/type_checker_perf/fast/rdar46939892.swift
./validation-test/Sema/type_checker_perf/fast/rdar31742586.swift
./validation-test/Sema/type_checker_perf/fast/rdar22282851.swift
./validation-test/Sema/type_checker_perf/fast/rdar32999041.swift.gyb
./validation-test/Sema/type_checker_perf/fast/rdar19738292.swift.gyb
./validation-test/Sema/type_checker_perf/fast/rdar30213053.swift.gyb
./validation-test/Sema/type_checker_perf/fast/rdar19357292.swift
./validation-test/Sema/type_checker_perf/fast/rdar46687985.swift
./validation-test/Sema/type_checker_perf/fast/rdar20233198_any.swift.gyb
./validation-test/Sema/type_checker_perf/fast/rdar32998180.swift
./validation-test/Sema/type_checker_perf/fast/rdar19181998_nominals.swift.gyb
./validation-test/Sema/type_checker_perf/fast/rdar28018866.swift
./validation-test/Sema/type_checker_perf/fast/rdar31439825.swift
./validation-test/Sema/type_checker_perf/fast/rdar19029974.swift
./validation-test/Sema/type_checker_perf/fast/rdar17024694.swift
./validation-test/Sema/type_checker_perf/fast/rdar20875936.swift
./validation-test/Sema/type_checker_perf/fast/rdar21720888.swift.gyb
./validation-test/Sema/type_checker_perf/fast/rdar20233198_explicit_overloads.swift.gyb
./validation-test/Sema/type_checker_perf/fast/rdar30389602.swift.gyb
./validation-test/Sema/type_checker_perf/fast/rdar32221800.swift
./validation-test/Sema/type_checker_perf/fast/rdar21328584.swift.gyb
./validation-test/Sema/type_checker_perf/fast/rdar23620262.swift
./validation-test/Sema/type_checker_perf/fast/rdar21930551.swift.gyb
./validation-test/Sema/type_checker_perf/fast/rdar23429943.swift
./validation-test/Sema/type_checker_perf/fast/rdar30729643.swift.gyb
./validation-test/Sema/type_checker_perf/fast/rdar21398466.swift
./validation-test/Sema/type_checker_perf/fast/rdar22770433.swift
./validation-test/Sema/type_checker_perf/fast/rdar24543332.swift.gyb
./validation-test/Sema/type_checker_perf/fast/expression_too_complex_4.swift
./validation-test/Sema/type_checker_perf/fast/rdar20233198_typed.swift.gyb
./validation-test/Sema/type_checker_perf/fast/rdar22249571.swift
./validation-test/Sema/type_checker_perf/fast/rdar33806601.swift
./validation-test/Sema/type_checker_perf/fast/rdar18360240.swift.gyb
./validation-test/Sema/type_checker_perf/fast/rdar46541800.swift
./validation-test/Sema/type_checker_perf/fast/rdar22532650.swift.gyb
./validation-test/Sema/type_checker_perf/fast/rdar29358447.swift.gyb
./validation-test/Sema/type_checker_perf/fast/rdar21374729.swift
./validation-test/Sema/type_checker_perf/fast/rdar20818064.swift.gyb
./validation-test/Sema/type_checker_perf/fast/rdar20959612.swift.gyb
./validation-test/Sema/type_checker_perf/fast/rdar17077404.swift
./validation-test/Sema/type_checker_perf/fast/rdar54580427.swift
./validation-test/Sema/type_checker_perf/fast/rdar31563957.swift.gyb
./validation-test/Sema/type_checker_perf/fast/rdar40344044.swift.gyb
./validation-test/Sema/type_checker_perf/fast/sr139.swift
./validation-test/Sema/type_checker_perf/fast/more_specialized_generic_func.swift.gyb
./validation-test/Sema/type_checker_perf/fast/rdar42672946.swift
./validation-test/Sema/type_checker_perf/fast/rdar20233198_named.swift.gyb
./validation-test/Sema/type_checker_perf/fast/rdar22626740.swift.gyb
./validation-test/Sema/type_checker_perf/fast/rdar19777895.swift.gyb
./validation-test/Sema/type_checker_perf/fast/rdar22836718.swift.gyb
./validation-test/Sema/type_checker_perf/fast/rdar19836070.swift
./validation-test/Sema/type_checker_perf/fast/rdar19157118.swift
./validation-test/Sema/type_checker_perf/fast/rdar19181998.swift.gyb
./validation-test/Sema/type_checker_perf/fast/rdar17170728.swift
./validation-test/Sema/type_checker_perf/fast/rdar19394804.swift.gyb
./validation-test/Sema/type_checker_perf/fast/rdar26939465.swift.gyb
./validation-test/Sema/type_checker_perf/fast/rdar33292740.swift.gyb
./validation-test/Sema/sr8493.swift
./validation-test/Sema/rdar30933988.swift
./validation-test/Sema/large-switch-rdar47365349.swift
./validation-test/Sema/rdar32204609.swift
./validation-test/Sema/interpolation_placeholders.swift
./validation-test/Sema/protocol_typo_correction.swift
./validation-test/Sema/explicit_coercions.swift
./validation-test/Sema/rdar47334176.swift
./validation-test/Sema/sr9644.swift
./validation-test/Sema/rdar34333874.swift
./validation-test/Sema/sr8209.swift
./validation-test/Sema/wmo_verify_loaded.swift
./validation-test/Sema/OverridesAndOverloads.swift
./validation-test/Sema/generic_function_signature.swift
./validation-test/Sema/Inputs
./validation-test/Sema/Inputs/rdar36801676_empty.swift
./validation-test/Sema/Inputs/sr8209-helper.swift
./validation-test/Sema/Inputs/sr8493-helper.swift
./validation-test/Sema/Inputs/sr9644-helper.swift
./validation-test/Sema/Inputs/rdar36801676.swift
./validation-test/Sema/Inputs/sr9644.h
./validation-test/Sema/Inputs/rdar30933988_enum.swift
./validation-test/Sema/Inputs/rdar47334176_types.swift
./validation-test/Sema/SwiftUI
./validation-test/Sema/SwiftUI/rdar57201781.swift
./validation-test/Sema/SwiftUI/rdar58972627.swift
./validation-test/Sema/SwiftUI/rdar56710317.swift
./validation-test/Sema/SwiftUI/rdar57410798.swift
./validation-test/compiler_crashers_fixed
./validation-test/compiler_crashers_fixed/02046-swift-pattern-operator.swift
./validation-test/compiler_crashers_fixed/25778-swift-type-print.swift
./validation-test/compiler_crashers_fixed/02003-swift-constraints-constraintsystem-addtypevariableconstraintstoworklist.swift
./validation-test/compiler_crashers_fixed/25869-swift-typechecker-resolveidentifiertype.swift
./validation-test/compiler_crashers_fixed/01737-swift-constraints-constraintgraphscope-constraintgraphscope.swift
./validation-test/compiler_crashers_fixed/00177-swift-constraints-constraintsystem-opengeneric.swift
./validation-test/compiler_crashers_fixed/02237-swift-parser-parsetypecomposition.swift
./validation-test/compiler_crashers_fixed/26639-void.swift
./validation-test/compiler_crashers_fixed/25931-std-function-func-mapsignaturetype.swift
./validation-test/compiler_crashers_fixed/01488-swift-lexer-leximpl.swift
./validation-test/compiler_crashers_fixed/26225-swift-iterabledeclcontext-getmembers.swift
./validation-test/compiler_crashers_fixed/00670-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/28604-isinheritedprotocolsvalid.swift
./validation-test/compiler_crashers_fixed/01351-swift-inflightdiagnostic-fixitreplacechars.swift
./validation-test/compiler_crashers_fixed/26854-swift-constraints-constraintsystem-matchdeepequalitytypes.swift
./validation-test/compiler_crashers_fixed/27869-swift-nominaltypedecl-computeinterfacetype.swift
./validation-test/compiler_crashers_fixed/27655-swift-constraints-solution-solution.swift
./validation-test/compiler_crashers_fixed/02252-swift-typechecker-resolveidentifiertype.swift
./validation-test/compiler_crashers_fixed/27217-swift-funcdecl-setdeserializedsignature.swift
./validation-test/compiler_crashers_fixed/01477-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/27852-swift-valuedecl-getoverloadsignature.swift
./validation-test/compiler_crashers_fixed/28463-child-source-range-not-contained-within-its-parent-guard-stmt.swift
./validation-test/compiler_crashers_fixed/27992-swift-createimplicitconstructor.swift
./validation-test/compiler_crashers_fixed/25874-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/00491-swift-type-transform.swift
./validation-test/compiler_crashers_fixed/26674-swift-sourcemanager-getbytedistance.swift
./validation-test/compiler_crashers_fixed/25981-llvm-smallvectorimpl-swift-decl-insert.swift
./validation-test/compiler_crashers_fixed/26614-swift-genericparamlist-deriveallarchetypes.swift
./validation-test/compiler_crashers_fixed/01713-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/26983-swift-archetypebuilder-potentialarchetype-isbetterarchetypeanchor.swift
./validation-test/compiler_crashers_fixed/00521-swift-tuplepattern-create.swift
./validation-test/compiler_crashers_fixed/02054-swift-diagnosticengine-flushactivediagnostic.swift
./validation-test/compiler_crashers_fixed/27093-swift-constraints-constraintsystem-solve.swift
./validation-test/compiler_crashers_fixed/27312-swift-substitutedtype-get.swift
./validation-test/compiler_crashers_fixed/01589-swift-constraints-constraintgraph-removeconstraint.swift
./validation-test/compiler_crashers_fixed/27317-swift-genericparamlist-addnestedarchetypes.swift
./validation-test/compiler_crashers_fixed/01517-swift-declname-printpretty.swift
./validation-test/compiler_crashers_fixed/27476-swift-modulefile-maybereadforeignerrorconvention.swift
./validation-test/compiler_crashers_fixed/26937-llvm-foldingset-swift-tupletype-nodeequals.swift
./validation-test/compiler_crashers_fixed/26824-swift-modulefile-getimportedmodules.swift
./validation-test/compiler_crashers_fixed/00451-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/25674-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/00934-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/00288-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/27893-swift-archetypebuilder-potentialarchetype-getarchetypeanchor.swift
./validation-test/compiler_crashers_fixed/26901-swift-typechecker-coercepatterntotype.swift
./validation-test/compiler_crashers_fixed/01678-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/26447-swift-parser-diagnose.swift
./validation-test/compiler_crashers_fixed/01924-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/27266-swift-constraints-constraintsystem-solverec.swift
./validation-test/compiler_crashers_fixed/27192-swift-dependentmembertype-get.swift
./validation-test/compiler_crashers_fixed/25654-swift-typechecker-typecheckdecl.swift
./validation-test/compiler_crashers_fixed/27532-swift-constraints-constraintsystem-matchdeepequalitytypes.swift
./validation-test/compiler_crashers_fixed/00993-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/00135-swift-modulefile-getdecl.swift
./validation-test/compiler_crashers_fixed/26344-swift-parser-parseexprclosure.swift
./validation-test/compiler_crashers_fixed/02148-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/00529-swift-type-transform.swift
./validation-test/compiler_crashers_fixed/25445-swift-type-transform.swift
./validation-test/compiler_crashers_fixed/02136-swift-lexer-lexidentifier.swift
./validation-test/compiler_crashers_fixed/28090-bool.swift
./validation-test/compiler_crashers_fixed/28389-swift-lookupvisibledecls.swift
./validation-test/compiler_crashers_fixed/01897-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/26592-swift-modulefile-gettype.swift
./validation-test/compiler_crashers_fixed/27989-swift-typechecker-lookupmember.swift
./validation-test/compiler_crashers_fixed/00803-void.swift
./validation-test/compiler_crashers_fixed/28516-child-source-range-not-contained-within-its-parent-guard-stmt.swift
./validation-test/compiler_crashers_fixed/27408-swift-removeshadoweddecls.swift
./validation-test/compiler_crashers_fixed/26662-swift-diagnosticengine-diagnose.swift
./validation-test/compiler_crashers_fixed/26642-swift-genericsignature-get.swift
./validation-test/compiler_crashers_fixed/25802-extractparameteroutline.swift
./validation-test/compiler_crashers_fixed/26806-swift-genericparamlist-create.swift
./validation-test/compiler_crashers_fixed/01722-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/28134-swift-typebase-getmembersubstitutions.swift
./validation-test/compiler_crashers_fixed/27884-swift-typechecker-callwitness.swift
./validation-test/compiler_crashers_fixed/28523-child-source-range-not-contained-within-its-parent-sequence-expr-type-null.swift
./validation-test/compiler_crashers_fixed/28719-currentconstraintsolverarena-no-constraint-solver-active.swift
./validation-test/compiler_crashers_fixed/00375-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/26374-swift-typechecker-getinterfacetypefrominternaltype.swift
./validation-test/compiler_crashers_fixed/27958-swift-typechecker-isdeclavailable.swift
./validation-test/compiler_crashers_fixed/27804-swift-constraints-constraintsystem-applysolution.swift
./validation-test/compiler_crashers_fixed/01496-swift-nominaltypedecl-getprotocols.swift
./validation-test/compiler_crashers_fixed/00703-swift-sourcemanager-addnewsourcebuffer.swift
./validation-test/compiler_crashers_fixed/27928-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/25569-swift-tupletype-get.swift
./validation-test/compiler_crashers_fixed/01842-swift-associatedtypedecl-associatedtypedecl.swift
./validation-test/compiler_crashers_fixed/00189-swift-tuplepattern-create.swift
./validation-test/compiler_crashers_fixed/25612-swift-patternbindingdecl-create.swift
./validation-test/compiler_crashers_fixed/25767-swift-constraints-constraintsystem-getfixedtyperecursive.swift
./validation-test/compiler_crashers_fixed/27043-swift-typechecker-typecheckexpressionshallow.swift
./validation-test/compiler_crashers_fixed/00171-std-function-func-swift-constraints-constraintsystem-simplifytype.swift
./validation-test/compiler_crashers_fixed/27494-swift-conformancelookuptable-lookupconformance.swift
./validation-test/compiler_crashers_fixed/00793-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/26310-swift-parser-parsedecl.swift
./validation-test/compiler_crashers_fixed/00573-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/25652-bool.swift
./validation-test/compiler_crashers_fixed/00180-szone-free-definite-size.swift
./validation-test/compiler_crashers_fixed/01989-void.swift
./validation-test/compiler_crashers_fixed/25772-swift-parser-parsenewdeclattribute.swift
./validation-test/compiler_crashers_fixed/27859-swift-constraints-constraintsystem-simplifyconformstoconstraint.swift
./validation-test/compiler_crashers_fixed/27323-swift-constraints-constraintgraph-addconstraint.swift
./validation-test/compiler_crashers_fixed/01996-swift-parser-parsedeclenumcase.swift
./validation-test/compiler_crashers_fixed/27271-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/00194-swift-parser-parseexprsequence.swift
./validation-test/compiler_crashers_fixed/01775-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/25475-swift-parser-parsedecl.swift
./validation-test/compiler_crashers_fixed/00630-llvm-smalldensemap-swift-constraints-constraint.swift
./validation-test/compiler_crashers_fixed/28195-swift-constraints-constraintsystem-resolveoverload.swift
./validation-test/compiler_crashers_fixed/28067-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/28723-unreachable-executed-at-swift-lib-sema-csdiag-cpp-4012.swift
./validation-test/compiler_crashers_fixed/01599-swift-constraints-constraintsystem-getfixedtyperecursive.swift
./validation-test/compiler_crashers_fixed/26277-swift-typechecker-resolvetypeincontext.swift
./validation-test/compiler_crashers_fixed/26861-swift-typechecker-resolveidentifiertype.swift
./validation-test/compiler_crashers_fixed/25789-swift-lexer-leximpl.swift
./validation-test/compiler_crashers_fixed/01476-swift-lexer-getlocforendoftoken.swift
./validation-test/compiler_crashers_fixed/00544-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/01191-swift-declcontext-lookupqualified.swift
./validation-test/compiler_crashers_fixed/26426-std-function-func-swift-constraints-constraintsystem-simplifytype.swift
./validation-test/compiler_crashers_fixed/01274-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/01999-swift-lexer-leximpl.swift
./validation-test/compiler_crashers_fixed/26695-swift-genericsignature-profile.swift
./validation-test/compiler_crashers_fixed/28826-type-haserror-should-not-be-assigning-a-type-involving-errortype.swift
./validation-test/compiler_crashers_fixed/01031-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/00763-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/26675-llvm-optional-swift-diagnostic-operator.swift
./validation-test/compiler_crashers_fixed/00115-swift-declcontext-lookupqualified.swift
./validation-test/compiler_crashers_fixed/02176-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/02044-swift-typechecker-typecheckpattern.swift
./validation-test/compiler_crashers_fixed/01407-swift-declname-printpretty.swift
./validation-test/compiler_crashers_fixed/00940-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/25824-swift-modulefile-maybereadgenericparams.swift
./validation-test/compiler_crashers_fixed/27115-swift-constraints-constraintsystem-simplifytype.swift
./validation-test/compiler_crashers_fixed/00618-swift-parser-parseexprsequence.swift
./validation-test/compiler_crashers_fixed/26322-swift-conformancelookuptable-expandimpliedconformances.swift
./validation-test/compiler_crashers_fixed/27940-swift-typechecker-resolvesuperclass.swift
./validation-test/compiler_crashers_fixed/27468-swift-funcdecl-isunaryoperator.swift
./validation-test/compiler_crashers_fixed/25487-llvm-bitstreamcursor-read.swift
./validation-test/compiler_crashers_fixed/00350-swift-constraints-constraintsystem-simplify.swift
./validation-test/compiler_crashers_fixed/26259-swift-protocoltype-canonicalizeprotocols.swift
./validation-test/compiler_crashers_fixed/01985-swift-parser-parsestmtforeach.swift
./validation-test/compiler_crashers_fixed/01093-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/27932-swift-constraints-constraintsystem-generateconstraints.swift
./validation-test/compiler_crashers_fixed/02139-swift-constraints-constraintgraphnode-addconstraint.swift
./validation-test/compiler_crashers_fixed/28464-child-source-range-not-contained-within-its-parent-guard-stmt.swift
./validation-test/compiler_crashers_fixed/26747-llvm-errs.swift
./validation-test/compiler_crashers_fixed/27639-swift-enumtype-get.swift
./validation-test/compiler_crashers_fixed/01982-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/28829-replacement-ismaterializable-cannot-substitute-with-a-non-materializable-type.swift
./validation-test/compiler_crashers_fixed/28142-swift-constraints-constraintsystem-simplifymemberconstraint.swift
./validation-test/compiler_crashers_fixed/00741-szone-malloc-should-clear.swift
./validation-test/compiler_crashers_fixed/02241-swift-diagnosticengine-diagnose.swift
./validation-test/compiler_crashers_fixed/27851-swift-structtype-get.swift
./validation-test/compiler_crashers_fixed/01937-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/26984-swift-dependentmembertype-get.swift
./validation-test/compiler_crashers_fixed/00347-llvm-smallvectorbase-grow-pod.swift
./validation-test/compiler_crashers_fixed/28206-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/01892-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/00571-swift-declcontext-lookupqualified.swift
./validation-test/compiler_crashers_fixed/27397-swift-patternbindingdecl-setpattern.swift
./validation-test/compiler_crashers_fixed/28869-swift-diagnosticengine-formatdiagnostictext-llvm-raw-ostream-llvm-stringref-llvm.swift
./validation-test/compiler_crashers_fixed/26907-swift-lexer-leximpl.swift
./validation-test/compiler_crashers_fixed/27759-swift-constraints-constraintsystem-diagnosefailureforexpr.swift
./validation-test/compiler_crashers_fixed/01204-swift-parser-parseexprpostfix.swift
./validation-test/compiler_crashers_fixed/28123-swift-constraints-constraintsystem-matchtypes.swift
./validation-test/compiler_crashers_fixed/01239-swift-constraints-constraintsystem-addtypevariableconstraintstoworklist.swift
./validation-test/compiler_crashers_fixed/27371-std-function-func-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/26202-swift-lexer-leximpl.swift
./validation-test/compiler_crashers_fixed/02118-swift-typechecker-checkinheritanceclause.swift
./validation-test/compiler_crashers_fixed/25492-swift-astcontext-allocate.swift
./validation-test/compiler_crashers_fixed/27990-swift-constraints-constraintsystem-computeassigndesttype.swift
./validation-test/compiler_crashers_fixed/01061-swift-typebase-gettypeofmember.swift
./validation-test/compiler_crashers_fixed/01828-swift-typealiasdecl-typealiasdecl.swift
./validation-test/compiler_crashers_fixed/00193-swift-typebase-gettypevariables.swift
./validation-test/compiler_crashers_fixed/28319-swift-typechecker-checkconformance.swift
./validation-test/compiler_crashers_fixed/01447-swift-parentype-get.swift
./validation-test/compiler_crashers_fixed/00936-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/26401-swift-typechecker-resolveidentifiertype.swift
./validation-test/compiler_crashers_fixed/00888-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/00593-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/27262-swift-modulefile-getdecl.swift
./validation-test/compiler_crashers_fixed/28599-false-should-have-found-context-by-now.swift
./validation-test/compiler_crashers_fixed/00427-void.swift
./validation-test/compiler_crashers_fixed/26052-swift-iterabledeclcontext-getmembers.swift
./validation-test/compiler_crashers_fixed/02159-swift-typechecker-typecheckexpression.swift
./validation-test/compiler_crashers_fixed/28268-swift-type-transform.swift
./validation-test/compiler_crashers_fixed/00373-swift-declcontext-lookupqualified.swift
./validation-test/compiler_crashers_fixed/00995-swift-tupletype-get.swift
./validation-test/compiler_crashers_fixed/00200-swift-parser-parsestmtreturn.swift
./validation-test/compiler_crashers_fixed/26159-llvm-foldingset-swift-structtype-nodeequals.swift
./validation-test/compiler_crashers_fixed/25642-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/00828-llvm-ondiskchainedhashtable-swift-modulefile-decltableinfo-find.swift
./validation-test/compiler_crashers_fixed/28818-hastype-e-expected-type-to-have-been-set.swift
./validation-test/compiler_crashers_fixed/01817-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/25978-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/02075-swift-nominaltypedecl-computetype.swift
./validation-test/compiler_crashers_fixed/27331-swift-patternbindingdecl-setpattern.swift
./validation-test/compiler_crashers_fixed/26635-swift-modulefile-getdecl.swift
./validation-test/compiler_crashers_fixed/25500-swift-lexer-lexidentifier.swift
./validation-test/compiler_crashers_fixed/01067-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/28353-swift-removeoverriddendecls.swift
./validation-test/compiler_crashers_fixed/27834-swift-constraints-constraintgraphscope-constraintgraphscope.swift
./validation-test/compiler_crashers_fixed/26133-llvm-foldingset-swift-constraints-constraintlocator-nodeequals.swift
./validation-test/compiler_crashers_fixed/28739-unreachable-executed-at-swift-lib-ast-type-cpp-229.swift
./validation-test/compiler_crashers_fixed/26681-swift-sourcemanager-getbytedistance.swift
./validation-test/compiler_crashers_fixed/26963-checkenumrawvalues.swift
./validation-test/compiler_crashers_fixed/26797-swift-generictypeparamtype-get.swift
./validation-test/compiler_crashers_fixed/27642-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/25495-void.swift
./validation-test/compiler_crashers_fixed/26422-swift-typevariabletype-implementation-assignfixedtype.swift
./validation-test/compiler_crashers_fixed/28357-swift-iterativetypechecker-processtypechecksuperclass.swift
./validation-test/compiler_crashers_fixed/26847-swift-valuedecl-getoverloadsignature.swift
./validation-test/compiler_crashers_fixed/28816-unreachable-executed-at-swift-lib-sema-typecheckgeneric-cpp-214.swift
./validation-test/compiler_crashers_fixed/26501-swift-lexer-leximpl.swift
./validation-test/compiler_crashers_fixed/28265-swift-expr-walk.swift
./validation-test/compiler_crashers_fixed/26191-swift-constraints-constraintsystem-addtypevariableconstraintstoworklist.swift
./validation-test/compiler_crashers_fixed/27066-swift-constraints-constraintsystem-applysolution.swift
./validation-test/compiler_crashers_fixed/26071-swift-valuedecl-settype.swift
./validation-test/compiler_crashers_fixed/28289-swift-type-transform.swift
./validation-test/compiler_crashers_fixed/00463-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/28021-swift-decl-getrawcomment.swift
./validation-test/compiler_crashers_fixed/01508-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/26085-swift-archetypebuilder-resolvearchetype.swift
./validation-test/compiler_crashers_fixed/01629-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/02030-std-function-func-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/25920-swift-patternbindingdecl-setpattern.swift
./validation-test/compiler_crashers_fixed/27374-swift-structtype-get.swift
./validation-test/compiler_crashers_fixed/28660-false-encountered-error-in-diagnostic-text.swift
./validation-test/compiler_crashers_fixed/27154-swift-modulefile-getdecl.swift
./validation-test/compiler_crashers_fixed/01012-swift-modulefile-getdecl.swift
./validation-test/compiler_crashers_fixed/02050-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/01707-swift-genericsignature-get.swift
./validation-test/compiler_crashers_fixed/01637-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/27578-void.swift
./validation-test/compiler_crashers_fixed/25367-swift-conformancelookuptable-updatelookuptable.swift
./validation-test/compiler_crashers_fixed/26625-swift-typechecker-resolveinheritanceclause.swift
./validation-test/compiler_crashers_fixed/00296-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/01615-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/26925-swift-constraints-constraintgraph-computeconnectedcomponents.swift
./validation-test/compiler_crashers_fixed/00545-llvm-prettystacktraceentry-prettystacktraceentry.swift
./validation-test/compiler_crashers_fixed/01576-swift-generictypeparamdecl-generictypeparamdecl.swift
./validation-test/compiler_crashers_fixed/01600-swift-availabilityattr-isunavailable.swift
./validation-test/compiler_crashers_fixed/25630-swift-typechecker-overapproximateosversionsatlocation.swift
./validation-test/compiler_crashers_fixed/00558-ioctl.swift
./validation-test/compiler_crashers_fixed/25995-swift-modulefile-getcommentfordecl.swift
./validation-test/compiler_crashers_fixed/01422-swift-parser-parsestmtreturn.swift
./validation-test/compiler_crashers_fixed/27894-swift-parser-parsedecl.swift
./validation-test/compiler_crashers_fixed/26472-swift-typebase-isequal.swift
./validation-test/compiler_crashers_fixed/01343-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/27146-llvm-foldingset-swift-structtype-nodeequals.swift
./validation-test/compiler_crashers_fixed/01335-swift-astvisitor.swift
./validation-test/compiler_crashers_fixed/25870-swift-sourcemanager-extracttext.swift
./validation-test/compiler_crashers_fixed/00300-swift-typebase-operator.swift
./validation-test/compiler_crashers_fixed/26062-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/28786-swift-typebase-getcontextsubstitutions-swift-declcontext-const-swift-genericenvi.swift
./validation-test/compiler_crashers_fixed/28617-child-source-range-not-contained-within-its-parent-guard-stmt.swift
./validation-test/compiler_crashers_fixed/00697-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/00311-clang-astreader-readtyperecord.swift
./validation-test/compiler_crashers_fixed/26466-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/25380-swift-parser-parsedecl.swift
./validation-test/compiler_crashers_fixed/01222-swift-nominaltypedecl-computetype.swift
./validation-test/compiler_crashers_fixed/02256-swift-sourcefile-getcache.swift
./validation-test/compiler_crashers_fixed/27828-swift-conformancelookuptable-getallprotocols.swift
./validation-test/compiler_crashers_fixed/28709-unreachable-executed-at-swift-lib-ast-type-cpp-1005.swift
./validation-test/compiler_crashers_fixed/25946-cleanupillformedexpression.swift
./validation-test/compiler_crashers_fixed/00820-x.swift
./validation-test/compiler_crashers_fixed/26089-swift-constraints-constraintsystem-getconstraintlocator.swift
./validation-test/compiler_crashers_fixed/26737-swift-structtype-get.swift
./validation-test/compiler_crashers_fixed/00018-swift-irgen-emitpolymorphicarguments.swift
./validation-test/compiler_crashers_fixed/25584-addnestedrequirements.swift
./validation-test/compiler_crashers_fixed/01666-llvm-foldingset-swift-boundgenerictype-nodeequals.swift
./validation-test/compiler_crashers_fixed/25351-swift-serialization-serializer-writenormalconformance.swift
./validation-test/compiler_crashers_fixed/00297-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/25897-swift-typebase-getsuperclass.swift
./validation-test/compiler_crashers_fixed/00141-swift-nominaltypedecl-getextensions.swift
./validation-test/compiler_crashers_fixed/01886-swift-typebase-operator.swift
./validation-test/compiler_crashers_fixed/28466-segfault-0xc27624-0xc2741f-0xc25bb5-0xbcdbbb.swift
./validation-test/compiler_crashers_fixed/00043-substdependenttypes.swift
./validation-test/compiler_crashers_fixed/25347-swift-typechecker-checkinheritanceclause.swift
./validation-test/compiler_crashers_fixed/00450-llvm-foldingsetimpl-findnodeorinsertpos.swift
./validation-test/compiler_crashers_fixed/26192-swift-maybeaddaccessorstovariable.swift
./validation-test/compiler_crashers_fixed/01296-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/00247-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/00059-fold-sequence.swift
./validation-test/compiler_crashers_fixed/01774-getmemberforbasetype.swift
./validation-test/compiler_crashers_fixed/25756-void.swift
./validation-test/compiler_crashers_fixed/27957-swift-inflightdiagnostic-fixitremove.swift
./validation-test/compiler_crashers_fixed/28376-swift-constraints-constraintsystem-diagnosefailureforexpr.swift
./validation-test/compiler_crashers_fixed/28459-child-source-range-not-contained-within-its-parent-guard-stmt.swift
./validation-test/compiler_crashers_fixed/01141-swift-parser-parseexprcallsuffix.swift
./validation-test/compiler_crashers_fixed/27800-swift-protocoltype-canonicalizeprotocols.swift
./validation-test/compiler_crashers_fixed/27404-swift-constraints-constraintlocator-profile.swift
./validation-test/compiler_crashers_fixed/02133-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/28520-args-size-fnref-getnumargumentsforfullapply-partial-application-was-throwing.swift
./validation-test/compiler_crashers_fixed/00205-swift-exprhandle-get.swift
./validation-test/compiler_crashers_fixed/00721-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/25687-swift-removeshadoweddecls.swift
./validation-test/compiler_crashers_fixed/01971-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/00214-swift-typebase-gettypeofmember.swift
./validation-test/compiler_crashers_fixed/25635-swift-expr-walk.swift
./validation-test/compiler_crashers_fixed/00361-swift-constraints-constraintgraph-gatherconstraints.swift
./validation-test/compiler_crashers_fixed/00249-swift-nominaltypedecl-computeinterfacetype.swift
./validation-test/compiler_crashers_fixed/01062-swift-typechecker-resolvetypeincontext.swift
./validation-test/compiler_crashers_fixed/27109-swift-diagnosticengine-flushactivediagnostic.swift
./validation-test/compiler_crashers_fixed/01161-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/27497-swift-decl-walk.swift
./validation-test/compiler_crashers_fixed/01019-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/26919-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/25516-swift-diagnosticengine-emitdiagnostic.swift
./validation-test/compiler_crashers_fixed/00510-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/28078-swift-archetypebuilder-inferrequirementswalker-walktotypepost.swift
./validation-test/compiler_crashers_fixed/25394-swift-parser-skipsingle.swift
./validation-test/compiler_crashers_fixed/25876-llvm-errs.swift
./validation-test/compiler_crashers_fixed/26356-swift-lexer-kindofidentifier.swift
./validation-test/compiler_crashers_fixed/01804-swift-modulefile-maybereadpattern.swift
./validation-test/compiler_crashers_fixed/25993-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/26717-swift-typevisitor.swift
./validation-test/compiler_crashers_fixed/27124-swift-modulefile-lookupvalue.swift
./validation-test/compiler_crashers_fixed/28712-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/25826-swift-modulefile-readmembers.swift
./validation-test/compiler_crashers_fixed/01049-swift-constraints-solution-solution.swift
./validation-test/compiler_crashers_fixed/25703-void.swift
./validation-test/compiler_crashers_fixed/27842-swift-conformancelookuptable-addprotocol.swift
./validation-test/compiler_crashers_fixed/27268-swift-astcontext-getsubstitutions.swift
./validation-test/compiler_crashers_fixed/27956-swift-expr-walk.swift
./validation-test/compiler_crashers_fixed/27335-swift-constraints-constraintsystem-assignfixedtype.swift
./validation-test/compiler_crashers_fixed/26427-swift-typechecker-getinterfacetypefrominternaltype.swift
./validation-test/compiler_crashers_fixed/01223-swift-lexer-leximpl.swift
./validation-test/compiler_crashers_fixed/26562-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/00805-swift-constraints-constraintsystem-opengeneric.swift
./validation-test/compiler_crashers_fixed/01166-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/26607-swift-parser-parsedecl.swift
./validation-test/compiler_crashers_fixed/28285-swift-typechecker-typecheckpattern.swift
./validation-test/compiler_crashers_fixed/28153-swift-normalprotocolconformance-setwitness.swift
./validation-test/compiler_crashers_fixed/27474-swift-typechecker-checkdeclarationavailability.swift
./validation-test/compiler_crashers_fixed/26275-llvm-optional-swift-diagnostic-operator.swift
./validation-test/compiler_crashers_fixed/00080-llvm-smallvectorimpl-swift-diagnosticargument-operator.swift
./validation-test/compiler_crashers_fixed/01301-swift-declcontext-lookupqualified.swift
./validation-test/compiler_crashers_fixed/27738-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/27510-swift-boundgenerictype-get.swift
./validation-test/compiler_crashers_fixed/28479-unreachable-executed-at-swift-include-swift-ast-typevisitor-h-39.swift
./validation-test/compiler_crashers_fixed/25513-swift-constraints-constraintsystem-simplifyconformstoconstraint.swift
./validation-test/compiler_crashers_fixed/25626-swift-nominaltypedecl-prepareextensions.swift
./validation-test/compiler_crashers_fixed/28177-swift-constraints-solution-coercetotype.swift
./validation-test/compiler_crashers_fixed/27278-swift-constraints-constraintgraph-computeconnectedcomponents.swift
./validation-test/compiler_crashers_fixed/25850-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/28212-swift-typechecker-resolvetypeincontext.swift
./validation-test/compiler_crashers_fixed/26450-swift-constraints-constraintsystem-applysolution.swift
./validation-test/compiler_crashers_fixed/26090-swift-constraints-constraintsystem-opengeneric.swift
./validation-test/compiler_crashers_fixed/01248-llvm-ondiskchainedhashtable-swift-modulefile-decltableinfo-find.swift
./validation-test/compiler_crashers_fixed/27880-swift-nominaltypedecl-preparelookuptable.swift
./validation-test/compiler_crashers_fixed/25727-swift-serialization-serializer-addconformanceref.swift
./validation-test/compiler_crashers_fixed/00385-swift-declcontext-lookupqualified.swift
./validation-test/compiler_crashers_fixed/26140-swift-modulefile-getdecl.swift
./validation-test/compiler_crashers_fixed/27062-std-function-func-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/26609-swift-parser-parsedecl.swift
./validation-test/compiler_crashers_fixed/25837-swift-parser-parsedeclfunc.swift
./validation-test/compiler_crashers_fixed/00682-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/27120-llvm-foldingset-swift-constraints-constraintlocator-nodeequals.swift
./validation-test/compiler_crashers_fixed/01960-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/26004-swift-diagnosticengine-emitdiagnostic.swift
./validation-test/compiler_crashers_fixed/27044-swift-functiontype-get.swift
./validation-test/compiler_crashers_fixed/00255-swift-tuplepattern-createsimple.swift
./validation-test/compiler_crashers_fixed/00760-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/27409-llvm-foldingset-swift-enumtype-nodeequals.swift
./validation-test/compiler_crashers_fixed/27967-swift-valuedecl-getoverloadsignature.swift
./validation-test/compiler_crashers_fixed/01928-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/25623-swift-modulefile-gettype.swift
./validation-test/compiler_crashers_fixed/01715-void.swift
./validation-test/compiler_crashers_fixed/00706-swift-constraints-constraintsystem-matchtypes.swift
./validation-test/compiler_crashers_fixed/26570-swift-valuedecl-getinterfacetype.swift
./validation-test/compiler_crashers_fixed/01367-swift-modulefile-getdecl.swift
./validation-test/compiler_crashers_fixed/27429-swift-typechecker-typecheckexpressionshallow.swift
./validation-test/compiler_crashers_fixed/27865-swift-conformancelookuptable-getimplicitprotocols.swift
./validation-test/compiler_crashers_fixed/25598-swift-genericsignature-get.swift
./validation-test/compiler_crashers_fixed/27068-swift-conformancelookuptable-conformancelookuptable.swift
./validation-test/compiler_crashers_fixed/01931-swift-protocolcompositiontype-build.swift
./validation-test/compiler_crashers_fixed/00773-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/25411-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/26823-swift-typebase-getmembersubstitutions.swift
./validation-test/compiler_crashers_fixed/01497-swift-bracestmt-create.swift
./validation-test/compiler_crashers_fixed/25557-swift-typebase-getanyoptionalobjecttype.swift
./validation-test/compiler_crashers_fixed/27459-swift-genericsignature-get.swift
./validation-test/compiler_crashers_fixed/01444-getcallerdefaultarg.swift
./validation-test/compiler_crashers_fixed/02002-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/26934-swift-lexer-leximpl.swift
./validation-test/compiler_crashers_fixed/01574-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/00983-a.swift
./validation-test/compiler_crashers_fixed/27376-swift-abstractstoragedecl-getobjcgetterselector.swift
./validation-test/compiler_crashers_fixed/28184-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/02085-swift-range-swift-nestedgenericparamlistiterator-swift-archetypetype.swift
./validation-test/compiler_crashers_fixed/27391-swift-typechecker-checkinheritanceclause.swift
./validation-test/compiler_crashers_fixed/02145-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/26166-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/25783-firsttarget.swift
./validation-test/compiler_crashers_fixed/02000-swift-constraints-constraintsystem-opengeneric.swift
./validation-test/compiler_crashers_fixed/27382-void.swift
./validation-test/compiler_crashers_fixed/26656-swift-lexer-lexstringliteral.swift
./validation-test/compiler_crashers_fixed/01419-swift-modulefile-maybereadgenericparams.swift
./validation-test/compiler_crashers_fixed/01558-swift-parser-parseexprunary.swift
./validation-test/compiler_crashers_fixed/27570-checkenumrawvalues.swift
./validation-test/compiler_crashers_fixed/01575-swift-modulefile-lookupvalue.swift
./validation-test/compiler_crashers_fixed/27203-swift-typeloc-iserror.swift
./validation-test/compiler_crashers_fixed/02100-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/26709-swift-parser-parseexprcallsuffix.swift
./validation-test/compiler_crashers_fixed/00357-swift-type-transform.swift
./validation-test/compiler_crashers_fixed/26022-swift-conformancelookuptable-getsatisfiedprotocolrequirementsformember.swift
./validation-test/compiler_crashers_fixed/27161-swift-typechecker-typecheckpattern.swift
./validation-test/compiler_crashers_fixed/28483-unreachable-executed-at-swift-lib-ast-type-cpp-1117.swift
./validation-test/compiler_crashers_fixed/02194-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/27431-swift-constraints-constraintsystem-finalize.swift
./validation-test/compiler_crashers_fixed/27926-swift-clangmoduleunit-lookupvalue.swift
./validation-test/compiler_crashers_fixed/28570-labelinfo-tryloc-isvalid-unlabeled-directives-should-be-handled-earlier.swift
./validation-test/compiler_crashers_fixed/01445-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/01241-swift-constraints-constraintsystem-assignfixedtype.swift
./validation-test/compiler_crashers_fixed/01917-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/28094-swift-parser-parsetypedpattern.swift
./validation-test/compiler_crashers_fixed/00421-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/27825-swift-functiontype-get.swift
./validation-test/compiler_crashers_fixed/27392-swift-constraints-constraintsystem-finalize.swift
./validation-test/compiler_crashers_fixed/00131-swift-lexer-lexnumber.swift
./validation-test/compiler_crashers_fixed/28241-swift-valuedecl-isaccessiblefrom.swift
./validation-test/compiler_crashers_fixed/28103-swift-parser-parsetoken.swift
./validation-test/compiler_crashers_fixed/00403-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/28321-swift-constraints-constraintsystem-resolveoverload.swift
./validation-test/compiler_crashers_fixed/25994-swift-typechecker-resolvetypeincontext.swift
./validation-test/compiler_crashers_fixed/28769-conformance-gettypewitness-assoctype-nullptr-isequal-type-conflicting-type-witne.swift
./validation-test/compiler_crashers_fixed/23086-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/26838-swift-patternbindingdecl-setpattern.swift
./validation-test/compiler_crashers_fixed/01979-swift-parser-parseexprclosure.swift
./validation-test/compiler_crashers_fixed/01827-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/01198-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/16694-swift-constraints-constraintsystem-opentype.swift
./validation-test/compiler_crashers_fixed/26600-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/02014-swift-parser-parsetypesimple.swift
./validation-test/compiler_crashers_fixed/10659-swift-printingdiagnosticconsumer-handlediagnostic.timeout.swift
./validation-test/compiler_crashers_fixed/25404-swift-lexer-leximpl.swift
./validation-test/compiler_crashers_fixed/00785-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/28572-anonymous-namespace-verifier-verifychecked-swift-type-llvm-smallptrset-swift-arc.swift
./validation-test/compiler_crashers_fixed/27338-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/24245-swift-constraints-constraintsystem-solve.swift
./validation-test/compiler_crashers_fixed/26325-swift-patternbindingdecl-setpattern.swift
./validation-test/compiler_crashers_fixed/25776-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/28417-swift-genericsignature-getsubstitutions.swift
./validation-test/compiler_crashers_fixed/27841-swift-parser-createbindingfrompattern.swift
./validation-test/compiler_crashers_fixed/01733-swift-tupletype-get.swift
./validation-test/compiler_crashers_fixed/28722-swift-genericsignaturebuilder-resolvearchetype-swift-type.swift
./validation-test/compiler_crashers_fixed/28380-swift-type-transform.swift
./validation-test/compiler_crashers_fixed/25902-swift-archetypebuilder-finalize.swift
./validation-test/compiler_crashers_fixed/28864-bool-typesig-bool-extensionsig-unexpected-generic-ness-mismatch-on-conformance.swift
./validation-test/compiler_crashers_fixed/26756-swift-unqualifiedlookup-unqualifiedlookup.swift
./validation-test/compiler_crashers_fixed/00539-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/28669-basety-islvaluetype-basety-is-anymetatypetype.swift
./validation-test/compiler_crashers_fixed/27138-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/25860-swift-parser-parsetypeidentifier.swift
./validation-test/compiler_crashers_fixed/00448-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/28112-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/25949-std-function-func-mapsignaturetype.swift
./validation-test/compiler_crashers_fixed/00314-swift-lowering-typeconverter-getloweredastfunctiontype.swift
./validation-test/compiler_crashers_fixed/27921-swift-conformancelookuptable-expandimpliedconformances.swift
./validation-test/compiler_crashers_fixed/27824-swift-modulefile-maybereadgenericparams.swift
./validation-test/compiler_crashers_fixed/01401-swift-typebase-getdesugaredtype.swift
./validation-test/compiler_crashers_fixed/01601-llvm-prettystacktraceentry-prettystacktraceentry.swift
./validation-test/compiler_crashers_fixed/27748-swift-conformancelookuptable-getimplicitprotocols.swift
./validation-test/compiler_crashers_fixed/27447-swift-diagnosticengine-flushactivediagnostic.swift
./validation-test/compiler_crashers_fixed/26688-swift-parser-parseexprcallsuffix.swift
./validation-test/compiler_crashers_fixed/27660-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/02171-swift-tupletype-get.swift
./validation-test/compiler_crashers_fixed/25607-swift-parserunit-implementation-implementation.swift
./validation-test/compiler_crashers_fixed/01203-swift-typebase-gettypeofmember.swift
./validation-test/compiler_crashers_fixed/28339-swift-typechecker-addimplicitconstructors.swift
./validation-test/compiler_crashers_fixed/00720-szone-malloc-should-clear.swift
./validation-test/compiler_crashers_fixed/25587-swift-typebase-getanyoptionalobjecttype.swift
./validation-test/compiler_crashers_fixed/27802-swift-constraints-constraintsystem-finalize.swift
./validation-test/compiler_crashers_fixed/00287-clang-astcontext-getobjcinterfacetype.swift
./validation-test/compiler_crashers_fixed/25774-swift-iterabledeclcontext-getmembers.swift
./validation-test/compiler_crashers_fixed/01689-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/27143-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/25845-swift-protocoltype-canonicalizeprotocols.swift
./validation-test/compiler_crashers_fixed/00666-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/01819-swift-typevisitor.swift
./validation-test/compiler_crashers_fixed/26256-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/26264-swift-conformancelookuptable-updatelookuptable.swift
./validation-test/compiler_crashers_fixed/28477-anonymous-namespace-declchecker-visitconstructordecl-swift-constructordecl.swift
./validation-test/compiler_crashers_fixed/02143-swift-structtype-get.swift
./validation-test/compiler_crashers_fixed/01312-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/25660-swift-typechecker-buildrefexpr.swift
./validation-test/compiler_crashers_fixed/00274-swift-typechecker-checkinheritanceclause.swift
./validation-test/compiler_crashers_fixed/26552-swift-parser-parsedecl.swift
./validation-test/compiler_crashers_fixed/25653-swift-tupletype-get.swift
./validation-test/compiler_crashers_fixed/01307-swift-clangmoduleunit-getimportedmodules.swift
./validation-test/compiler_crashers_fixed/00889-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/01346-swift-tupletype-get.swift
./validation-test/compiler_crashers_fixed/28136-swift-valuedecl-getinterfacetype.swift
./validation-test/compiler_crashers_fixed/00994-swift-typealiasdecl.swift
./validation-test/compiler_crashers_fixed/27638-swift-structtype-get.swift
./validation-test/compiler_crashers_fixed/27047-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/27170-swift-protocoltype-canonicalizeprotocols.swift
./validation-test/compiler_crashers_fixed/27441-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/28341-swift-typechecker-typecheckdecl.swift
./validation-test/compiler_crashers_fixed/26949-swift-typeloc-iserror.swift
./validation-test/compiler_crashers_fixed/02006-swift-typebase-getdesugaredtype.swift
./validation-test/compiler_crashers_fixed/00980-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/00780-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/01106-swift-constraints-constraintsystem-addconstraint.swift
./validation-test/compiler_crashers_fixed/02172-swift-boundgenerictype-get.swift
./validation-test/compiler_crashers_fixed/27791-swift-conformancelookuptable-updatelookuptable.swift
./validation-test/compiler_crashers_fixed/00396-llvm-raw-fd-ostream-write-impl.random.swift
./validation-test/compiler_crashers_fixed/27676-swift-moduledecl-lookupvalue.swift
./validation-test/compiler_crashers_fixed/25428-swift-nominaltypedecl-prepareextensions.swift
./validation-test/compiler_crashers_fixed/27867-swift-typerepr-getsourcerange.swift
./validation-test/compiler_crashers_fixed/28555-unreachable-executed-at-swift-lib-ast-type-cpp-1318.swift
./validation-test/compiler_crashers_fixed/01281-swift-lexer-leximpl.swift
./validation-test/compiler_crashers_fixed/26964-swift-type-transform.swift
./validation-test/compiler_crashers_fixed/02161-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/01705-vtable.swift
./validation-test/compiler_crashers_fixed/26019-swift-compilerinvocation-parseargs.swift
./validation-test/compiler_crashers_fixed/26698-swift-genericsignature-genericsignature.swift
./validation-test/compiler_crashers_fixed/02201-std-function-func-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/26638-bool.swift
./validation-test/compiler_crashers_fixed/26352-swift-modulefile-getimportedmodules.swift
./validation-test/compiler_crashers_fixed/26155-swift-constraints-constraintgraph-change-undo.swift
./validation-test/compiler_crashers_fixed/28116-swift-parser-skipsingle.swift
./validation-test/compiler_crashers_fixed/25364-swift-parser-parsetoken.swift
./validation-test/compiler_crashers_fixed/28178-swift-astcontext-getprotocol.swift
./validation-test/compiler_crashers_fixed/26160-swift-astcontext-getidentifier.swift
./validation-test/compiler_crashers_fixed/28665-result-case-not-implemented.swift
./validation-test/compiler_crashers_fixed/02234-bool.swift
./validation-test/compiler_crashers_fixed/01756-swift-constraints-constraintsystem-matchfunctiontypes.swift
./validation-test/compiler_crashers_fixed/00372-swift-declcontext-lookupqualified.swift
./validation-test/compiler_crashers_fixed/28657-unreachable-executed-at-swift-lib-ast-type-cpp-1344.swift
./validation-test/compiler_crashers_fixed/02086-swift-modulefile-getdecl.swift
./validation-test/compiler_crashers_fixed/28437-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/26213-swift-typechecker-resolvetypeincontext.swift
./validation-test/compiler_crashers_fixed/27311-swift-typechecker-typecheckexpression.swift
./validation-test/compiler_crashers_fixed/26720-void.swift
./validation-test/compiler_crashers_fixed/02112-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/01201-swift-declcontext-lookupqualified.swift
./validation-test/compiler_crashers_fixed/00904-swift-completegenerictyperesolver-resolvedependentmembertype.swift
./validation-test/compiler_crashers_fixed/01887-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/26726-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/01929-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/01542-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/01250-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/25508-swift-archetypebuilder-addrequirement.swift
./validation-test/compiler_crashers_fixed/00468-swift-parentype-get.swift
./validation-test/compiler_crashers_fixed/27631-swift-nominaltypedecl-getmembers.swift
./validation-test/compiler_crashers_fixed/27481-swift-conformancelookuptable-resolveconformances.swift
./validation-test/compiler_crashers_fixed/26413-swift-sourcemanager-getbytedistance.swift
./validation-test/compiler_crashers_fixed/27730-swift-modulefile-resolvecrossreference.swift
./validation-test/compiler_crashers_fixed/01649-swift-constraints-constraintgraph-change-undo.swift
./validation-test/compiler_crashers_fixed/27838-swift-conformancelookuptable-updatelookuptable.swift
./validation-test/compiler_crashers_fixed/26755-swift-constraints-constraintsystem-solverstate-solverstate.swift
./validation-test/compiler_crashers_fixed/28508-unreachable-executed-at-swift-lib-sema-csgen-cpp-2656.swift
./validation-test/compiler_crashers_fixed/27269-void.swift
./validation-test/compiler_crashers_fixed/26136-swift-astcontext-getloadedmodule.swift
./validation-test/compiler_crashers_fixed/27064-swift-conformancelookuptable-updatelookuptable.swift
./validation-test/compiler_crashers_fixed/27625-swift-typechecker-typecheckpattern.swift
./validation-test/compiler_crashers_fixed/00067-szone-malloc-should-clear.swift
./validation-test/compiler_crashers_fixed/25851-swift-typechecker-resolveidentifiertype.swift
./validation-test/compiler_crashers_fixed/27381-std-function-func-mapsignaturetype.swift
./validation-test/compiler_crashers_fixed/01043-llvm-smallvectorimpl-swift-diagnosticargument-operator.swift
./validation-test/compiler_crashers_fixed/27455-swift-modulefile-loadextensions.swift
./validation-test/compiler_crashers_fixed/26382-swift-modulefile-gettype.swift
./validation-test/compiler_crashers_fixed/00661-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/02188-swift-diagnosticengine-flushactivediagnostic.swift
./validation-test/compiler_crashers_fixed/28245-swift-dependentgenerictyperesolver-resolveselfassociatedtype.swift
./validation-test/compiler_crashers_fixed/00570-swift-declcontext-lookupqualified.swift
./validation-test/compiler_crashers_fixed/00517-swift-constraints-solution-computesubstitutions.swift
./validation-test/compiler_crashers_fixed/26867-std-function-func-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/23680-std-function-func-swift-archetypebuilder-maptypeintocontext.swift
./validation-test/compiler_crashers_fixed/00466-swift-constraints-constraintsystem-getfixedtyperecursive.swift
./validation-test/compiler_crashers_fixed/01213-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/26347-swift-parser-parsedecl.swift
./validation-test/compiler_crashers_fixed/01644-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/28439-swift-type-transform.swift
./validation-test/compiler_crashers_fixed/26759-swift-parser-skipsingle.swift
./validation-test/compiler_crashers_fixed/01584-swift-constraints-constraintsystem-getfixedtyperecursive.swift
./validation-test/compiler_crashers_fixed/01424-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/25422-swift-nominaltypedecl-setgenericsignature.swift
./validation-test/compiler_crashers_fixed/25707-swift-inouttype-get.swift
./validation-test/compiler_crashers_fixed/28792-conforms-equivclass-conformsto-end.swift
./validation-test/compiler_crashers_fixed/00860-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/25483-swift-performexprdiagnostics.swift
./validation-test/compiler_crashers_fixed/25647-swift-astcontext-setrawcomment.swift
./validation-test/compiler_crashers_fixed/25862-swift-astcontext-allocate.swift
./validation-test/compiler_crashers_fixed/26103-swift-constraints-constraintsystem-solve.swift
./validation-test/compiler_crashers_fixed/25418-swift-typechecker-validatetype.swift
./validation-test/compiler_crashers_fixed/27493-swift-parser-consumetoken.swift
./validation-test/compiler_crashers_fixed/25646-swift-parser-applyattributetotype.swift
./validation-test/compiler_crashers_fixed/25521-swift-ide-printdeclusr.swift
./validation-test/compiler_crashers_fixed/26009-swift-lexer-kindofidentifier.swift
./validation-test/compiler_crashers_fixed/28823-impl-getgraphindex-typevariables-size-out-of-bounds-index.swift
./validation-test/compiler_crashers_fixed/25932-swift-parser-parsedecl.swift
./validation-test/compiler_crashers_fixed/27290-vtable.swift
./validation-test/compiler_crashers_fixed/24531-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/25515-swift-memberlookuptable-addmember.swift
./validation-test/compiler_crashers_fixed/00557-swift-constraints-constraintsystem-getfixedtyperecursive.swift
./validation-test/compiler_crashers_fixed/28074-swift-archetypebuilder-potentialarchetype-gettype.swift
./validation-test/compiler_crashers_fixed/25975-swift-unqualifiedlookup-unqualifiedlookup.swift
./validation-test/compiler_crashers_fixed/01950-swift-modulefile-lookupvalue.swift
./validation-test/compiler_crashers_fixed/28058-swift-lexer-leximpl.swift
./validation-test/compiler_crashers_fixed/25399-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/01461-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/01901-swift-constraints-constraintsystem-matchtypes.swift
./validation-test/compiler_crashers_fixed/25450-void.swift
./validation-test/compiler_crashers_fixed/01541-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/28104-void.swift
./validation-test/compiler_crashers_fixed/01714-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/25823-swift-typechecker-coercepatterntotype.swift
./validation-test/compiler_crashers_fixed/26237-swift-modulefile-maybereadforeignerrorconvention.swift
./validation-test/compiler_crashers_fixed/00696-std-function-func-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/26542-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/01095-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/01682-swift-parser-parsedecl.swift
./validation-test/compiler_crashers_fixed/25395-std-function-func.swift
./validation-test/compiler_crashers_fixed/00707-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/25604-swift-funcdecl-funcdecl.swift
./validation-test/compiler_crashers_fixed/01004-swift-nominaltypedecl-computetype.swift
./validation-test/compiler_crashers_fixed/01499-swift-typechecker-coercepatterntotype.swift
./validation-test/compiler_crashers_fixed/01216-swift-boundgenerictype-get.swift
./validation-test/compiler_crashers_fixed/26271-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/00097-swift-clangmoduleunit-getimportedmodules.swift
./validation-test/compiler_crashers_fixed/27522-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/01170-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/01360-void.swift
./validation-test/compiler_crashers_fixed/25854-swift-conformancelookuptable-updatelookuptable.swift
./validation-test/compiler_crashers_fixed/25757-bool.swift
./validation-test/compiler_crashers_fixed/27844-swift-typechecker-getinterfacetypefrominternaltype.swift
./validation-test/compiler_crashers_fixed/00070-getgenericparam.swift
./validation-test/compiler_crashers_fixed/28813-swift-genericsignature-enumeratepairedrequirements-llvm-function-ref-bool-swift-.swift
./validation-test/compiler_crashers_fixed/01867-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/26069-swift-archetypebuilder-potentialarchetype-getdependenttype.swift
./validation-test/compiler_crashers_fixed/01812-swift-lexer-getlocforendoftoken.swift
./validation-test/compiler_crashers_fixed/26643-resolveidenttypecomponent.swift
./validation-test/compiler_crashers_fixed/26198-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/28474-unreachable-executed-at-swift-lib-ast-type-cpp-1325.swift
./validation-test/compiler_crashers_fixed/26632-llvm-foldingset-swift-constraints-constraintlocator-nodeequals.swift
./validation-test/compiler_crashers_fixed/02243-swift-boundgenerictype-get.swift
./validation-test/compiler_crashers_fixed/00393-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/00083-std-function-func-mapsignaturetype.swift
./validation-test/compiler_crashers_fixed/25474-swift-parser-diagnose.swift
./validation-test/compiler_crashers_fixed/00064-bool.swift
./validation-test/compiler_crashers_fixed/28083-swift-enumtype-get.swift
./validation-test/compiler_crashers_fixed/28854-known-typewitnesses-end-didnt-resolve-witness.swift
./validation-test/compiler_crashers_fixed/25832-resolveidenttypecomponent.swift
./validation-test/compiler_crashers_fixed/27084-swift-abstractclosureexpr-setparams.swift
./validation-test/compiler_crashers_fixed/27111-swift-valuedecl-getoverloadsignature.swift
./validation-test/compiler_crashers_fixed/26617-swift-inouttype-get.swift
./validation-test/compiler_crashers_fixed/25901-swift-typechecker-resolveidentifiertype.swift
./validation-test/compiler_crashers_fixed/25878-swift-diagnosticengine-emitdiagnostic.swift
./validation-test/compiler_crashers_fixed/26016-swift-modulefile-getimportedmodules.swift
./validation-test/compiler_crashers_fixed/27012-swift-constraints-constraintsystem-solvesimplified.swift
./validation-test/compiler_crashers_fixed/28637-swift-tupletype-get-llvm-arrayref-swift-tupletypeelt-swift-astcontext-const.swift
./validation-test/compiler_crashers_fixed/27777-swift-clangimporter-loadextensions.swift
./validation-test/compiler_crashers_fixed/01667-swift-parser-parseexprpostfix.swift
./validation-test/compiler_crashers_fixed/28095-swift-parser-parsedeclstruct.swift
./validation-test/compiler_crashers_fixed/00567-swift-constraints-constraintsystem-matchtypes.swift
./validation-test/compiler_crashers_fixed/02078-swift-parser-parsedeclinit.swift
./validation-test/compiler_crashers_fixed/02080-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/28001-swift-parser-parsetypesimple.swift
./validation-test/compiler_crashers_fixed/01102-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/00601-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/27056-swift-classtype-get.swift
./validation-test/compiler_crashers_fixed/26936-std-function-func-mapsignaturetype.swift
./validation-test/compiler_crashers_fixed/01824-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/01399-swift-modulefile-getdecl.swift
./validation-test/compiler_crashers_fixed/26011-swift-typechecker-definedefaultconstructor.swift
./validation-test/compiler_crashers_fixed/27737-swift-parentype-get.swift
./validation-test/compiler_crashers_fixed/26391-swift-scopeinfo-addtoscope.swift
./validation-test/compiler_crashers_fixed/28010-swift-typechecker-typecheckdecl.swift
./validation-test/compiler_crashers_fixed/01880-swift-typechecker-checksubstitutions.swift
./validation-test/compiler_crashers_fixed/26361-swift-constraints-constraintgraph-computeconnectedcomponents.swift
./validation-test/compiler_crashers_fixed/10248-swift-streamprinter-printtext.swift
./validation-test/compiler_crashers_fixed/26109-swift-constraints-constraintsystem-solvesimplified.swift
./validation-test/compiler_crashers_fixed/00354-swift-modulefile-maybereadpattern.swift
./validation-test/compiler_crashers_fixed/01874-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/02193-swift-typechecker-resolvetypeincontext.swift
./validation-test/compiler_crashers_fixed/00220-llvm-foldingsetimpl-findnodeorinsertpos.swift
./validation-test/compiler_crashers_fixed/25415-swift-astcontext-getimplicitlyunwrappedoptionaldecl.swift
./validation-test/compiler_crashers_fixed/28229-swift-valuedecl-getinterfacetype.swift
./validation-test/compiler_crashers_fixed/25451-swift-scopeinfo-addtoscope.swift
./validation-test/compiler_crashers_fixed/00103-swift-constraints-constraintsystem-diagnosefailurefromconstraints.swift
./validation-test/compiler_crashers_fixed/26265-swift-constraints-constraintsystem-getfixedtyperecursive.swift
./validation-test/compiler_crashers_fixed/27023-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/00616-swift-parser-parsedecl.swift
./validation-test/compiler_crashers_fixed/28378-swift-typechecker-resolvewitness.swift
./validation-test/compiler_crashers_fixed/27034-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/28631-unreachable-executed-at-swift-lib-ast-type-cpp-1130.swift
./validation-test/compiler_crashers_fixed/28517-getstoragekind-stored-storagekind-already-set.swift
./validation-test/compiler_crashers_fixed/01174-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/00938-swift-constraints-constraintsystem-matchtypes.swift
./validation-test/compiler_crashers_fixed/26224-swift-astcontext-allocate.swift
./validation-test/compiler_crashers_fixed/00628-swift-clangmoduleunit-getadaptermodule.swift
./validation-test/compiler_crashers_fixed/02077-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/26972-swift-type-transform.swift
./validation-test/compiler_crashers_fixed/28720-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/27601-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/26946-swift-conformancelookuptable-updatelookuptable.swift
./validation-test/compiler_crashers_fixed/27132-swift-availabilityinference-applyinferredavailableattrs.swift
./validation-test/compiler_crashers_fixed/28163-swift-astcontext-getoptionaldecl.swift
./validation-test/compiler_crashers_fixed/00765-swift-langoptions-gettargetconfigoption.swift
./validation-test/compiler_crashers_fixed/01208-swift-modulefile-getdecl.swift
./validation-test/compiler_crashers_fixed/28692-unreachable-executed-at-swift-lib-ast-type-cpp-1349.swift
./validation-test/compiler_crashers_fixed/25550-swift-unboundgenerictype-get.swift
./validation-test/compiler_crashers_fixed/01613-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/28444-resolver-unable-to-resolve-type-witness-failed.swift
./validation-test/compiler_crashers_fixed/28538-swift-removeshadoweddecls-llvm-smallvectorimpl-swift-valuedecl-swift-moduledecl-.swift
./validation-test/compiler_crashers_fixed/28683-result-case-not-implemented.swift
./validation-test/compiler_crashers_fixed/00578-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/26333-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/26150-swift-genericsignature-genericsignature.swift
./validation-test/compiler_crashers_fixed/26523-swift-constraints-constraintgraph-gatherconstraints.swift
./validation-test/compiler_crashers_fixed/02183-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/25356-swift-diagnosticengine-emitdiagnostic.swift
./validation-test/compiler_crashers_fixed/00286-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/27314-swift-markasobjc.swift
./validation-test/compiler_crashers_fixed/26240-swift-astcontext-allocate.swift
./validation-test/compiler_crashers_fixed/01723-swift-optional-swift-diagnostic-operator.swift
./validation-test/compiler_crashers_fixed/26211-swift-typechecker-coercepatterntotype.swift
./validation-test/compiler_crashers_fixed/25987-swift-unqualifiedlookup-unqualifiedlookup.swift
./validation-test/compiler_crashers_fixed/27729-swift-typechecker-coercepatterntotype.swift
./validation-test/compiler_crashers_fixed/00844-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/01940-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/28292-swift-valuedecl-settype.swift
./validation-test/compiler_crashers_fixed/25427-swift-typechecker-resolveidentifiertype.swift
./validation-test/compiler_crashers_fixed/01425-swift-constraints-constraintsystem-getfixedtyperecursive.swift
./validation-test/compiler_crashers_fixed/01463-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/27349-llvm-ondiskchainedhashtable-swift-modulefile-decltableinfo-find.swift
./validation-test/compiler_crashers_fixed/00431-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/26437-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/00419-llvm-raw-fd-ostream-write-impl.swift
./validation-test/compiler_crashers_fixed/28035-swift-archetypebuilder-getallarchetypes.swift
./validation-test/compiler_crashers_fixed/25875-swift-valuedecl-overwritetype.swift
./validation-test/compiler_crashers_fixed/01990-swift-modulefile-lookupvalue.swift
./validation-test/compiler_crashers_fixed/25914-swift-typebase-isequal.swift
./validation-test/compiler_crashers_fixed/26879-swift-constraints-constraintgraphscope-constraintgraphscope.swift
./validation-test/compiler_crashers_fixed/25405-swift-parser-parsedecl.swift
./validation-test/compiler_crashers_fixed/25968-std-function-func-mapsignaturetype.swift
./validation-test/compiler_crashers_fixed/01478-swift-boundgenerictype-get.swift
./validation-test/compiler_crashers_fixed/28424-swift-valuedecl-getformalaccessscope.swift
./validation-test/compiler_crashers_fixed/01831-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/27949-swift-genericparamlist-create.swift
./validation-test/compiler_crashers_fixed/28605-anonymous-namespace-verifier-verifychecked-swift-type-llvm-smallptrset-swift-arc.swift
./validation-test/compiler_crashers_fixed/27999-swift-constraints-solution-solution.swift
./validation-test/compiler_crashers_fixed/28607-hasinterfacetype-no-interface-type-was-set.swift
./validation-test/compiler_crashers_fixed/26762-swift-constraints-constraintgraph-addconstraint.swift
./validation-test/compiler_crashers_fixed/27298-swift-modulefile-gettype.swift
./validation-test/compiler_crashers_fixed/28271-swift-archetypebuilder-getallarchetypes.swift
./validation-test/compiler_crashers_fixed/02240-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/02189-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/00933-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/25409-llvm-foldingset-swift-tupletype-nodeequals.swift
./validation-test/compiler_crashers_fixed/25833-swift-typechecker-validatetype.swift
./validation-test/compiler_crashers_fixed/26651-swift-genericsignature-get.swift
./validation-test/compiler_crashers_fixed/28334-swift-typechecker-resolvetypewitness.swift
./validation-test/compiler_crashers_fixed/01344-swift-typechecker-checksubstitutions.swift
./validation-test/compiler_crashers_fixed/28773-unreachable-executed-at-swift-lib-sema-cssimplify-cpp-4808.swift
./validation-test/compiler_crashers_fixed/27603-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/25430-swift-dependentmembertype-get.swift
./validation-test/compiler_crashers_fixed/01515-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/28122-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/27560-swift-typechecker-addimplicitconstructors.swift
./validation-test/compiler_crashers_fixed/28673-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/26239-swift-parser-parsedeclvar.swift
./validation-test/compiler_crashers_fixed/26441-swift-parser-parseexprcollection.swift
./validation-test/compiler_crashers_fixed/01698-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/01849-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/01409-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/00551-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/28844-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/26734-swift-diagnosticengine-flushactivediagnostic.swift
./validation-test/compiler_crashers_fixed/25692-std-function-func-mapsignaturetype.swift
./validation-test/compiler_crashers_fixed/26825-std-function-func-mapsignaturetype.swift
./validation-test/compiler_crashers_fixed/00411-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/01155-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/27026-void.swift
./validation-test/compiler_crashers_fixed/25679-swift-declrefexpr-setspecialized.swift
./validation-test/compiler_crashers_fixed/26537-swift-abstractstoragedecl-getobjcgetterselector.swift
./validation-test/compiler_crashers_fixed/01587-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/01720-swift-clangmoduleunit-getimportedmodules.swift
./validation-test/compiler_crashers_fixed/26339-llvm-ondiskchainedhashtable-swift-modulefile-decltableinfo-find.swift
./validation-test/compiler_crashers_fixed/27702-swift-conformancelookuptable-resolveconformances.swift
./validation-test/compiler_crashers_fixed/00137-swift-modulefile-gettype.swift
./validation-test/compiler_crashers_fixed/01464-llvm-bitstreamcursor-readabbreviatedfield.swift
./validation-test/compiler_crashers_fixed/27506-swift-modulefile-gettype.swift
./validation-test/compiler_crashers_fixed/27249-std-function-func.swift
./validation-test/compiler_crashers_fixed/27227-swift-constraints-constraintsystem-lookthroughimplicitlyunwrappedoptionaltype.swift
./validation-test/compiler_crashers_fixed/01143-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/27032-swift-nominaltypedecl-computeinterfacetype.swift
./validation-test/compiler_crashers_fixed/01581-swift-pattern-foreachvariable.swift
./validation-test/compiler_crashers_fixed/00861-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/28135-swift-parser-parseexprlist.swift
./validation-test/compiler_crashers_fixed/00075-llvm-foldingset-swift-boundgenerictype-nodeequals.swift
./validation-test/compiler_crashers_fixed/00594-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/00504-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/01522-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/28218-swift-valuedecl-settype.swift
./validation-test/compiler_crashers_fixed/27264-swift-modulefile-maybereadgenericparams.swift
./validation-test/compiler_crashers_fixed/27533-swift-ide-printdeclusr.swift
./validation-test/compiler_crashers_fixed/25629-swift-astcontext-allocate.swift
./validation-test/compiler_crashers_fixed/26027-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/27652-swift-typechecker-checkdeclattributes.swift
./validation-test/compiler_crashers_fixed/27156-swift-typechecker-applygenericarguments.swift
./validation-test/compiler_crashers_fixed/02204-swift-clangmoduleunit-getadaptermodule.swift
./validation-test/compiler_crashers_fixed/00063-tiny-malloc-from-free-list.swift
./validation-test/compiler_crashers_fixed/00349-swift-typechecker-resolveidentifiertype.swift
./validation-test/compiler_crashers_fixed/26974-swift-typechecker-checkinheritanceclause.swift
./validation-test/compiler_crashers_fixed/27244-swift-lexer-lexoperatoridentifier.swift
./validation-test/compiler_crashers_fixed/00896-void.swift
./validation-test/compiler_crashers_fixed/00231-swift-constraints-constraintlocator-profile.swift
./validation-test/compiler_crashers_fixed/01550-swift-genericfunctiontype-get.swift
./validation-test/compiler_crashers_fixed/25463-swift-typebase-getanyoptionalobjecttype.swift
./validation-test/compiler_crashers_fixed/28734-conformingreplacementtype-is-substitutabletype-conformingreplacementtype-is-depe.swift
./validation-test/compiler_crashers_fixed/26043-swift-inflightdiagnostic-fixitreplacechars.swift
./validation-test/compiler_crashers_fixed/25498-swift-constraints-constraint-constraint.swift
./validation-test/compiler_crashers_fixed/00485-swift-declcontext-lookupqualified.swift
./validation-test/compiler_crashers_fixed/27388-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/28098-swift-constraints-constraintsystem-performmemberlookup.swift
./validation-test/compiler_crashers_fixed/28553-resolver-unable-to-resolve-type-witness.swift
./validation-test/compiler_crashers_fixed/26354-vtable.swift
./validation-test/compiler_crashers_fixed/28254-swift-enumelementdecl-getargumentinterfacetype.swift
./validation-test/compiler_crashers_fixed/27172-swift-typebase-isemptyexistentialcomposition.swift
./validation-test/compiler_crashers_fixed/27316-swift-constraints-constraintsystem-solverscope-solverscope.swift
./validation-test/compiler_crashers_fixed/00168-swift-typebase-isspecialized.swift
./validation-test/compiler_crashers_fixed/28454-hasval-failed.swift
./validation-test/compiler_crashers_fixed/28379-swift-constraints-constraintsystem-diagnosefailureforexpr.swift
./validation-test/compiler_crashers_fixed/28320-swift-archetypebuilder-enumeraterequirements.swift
./validation-test/compiler_crashers_fixed/24624-swift-module-lookupconformance.swift
./validation-test/compiler_crashers_fixed/01094-swift-modulefile-getdecl.swift
./validation-test/compiler_crashers_fixed/00409-llvm-raw-fd-ostream-write-impl.swift
./validation-test/compiler_crashers_fixed/00399-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/00932-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/25913-swift-valuedecl-settype.swift
./validation-test/compiler_crashers_fixed/01039-swift-typechecker-conformstoprotocol.swift
./validation-test/compiler_crashers_fixed/27644-llvm-optional-swift-diagnostic-operator.swift
./validation-test/compiler_crashers_fixed/28546-anonymous-namespace-verifier-walktodeclpost-swift-decl.swift
./validation-test/compiler_crashers_fixed/27389-swift-typeexpr-typeexpr.swift
./validation-test/compiler_crashers_fixed/27483-swift-namelookup-findlocalval-visitbracestmt.swift
./validation-test/compiler_crashers_fixed/25583-swift-substitutedtype-get.swift
./validation-test/compiler_crashers_fixed/28277-swift-archetypebuilder-getgenericsignature.swift
./validation-test/compiler_crashers_fixed/26282-swift-genericsignature-genericsignature.swift
./validation-test/compiler_crashers_fixed/00719-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/00109-swift-constraints-constraintsystem-matchfunctiontypes.swift
./validation-test/compiler_crashers_fixed/28132-swift-namelookup-findlocalval-visitifstmt.swift
./validation-test/compiler_crashers_fixed/28768-isactuallycanonicalornull-forming-a-cantype-out-of-a-non-canonical-type.swift
./validation-test/compiler_crashers_fixed/00449-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/26269-swift-modulefile-readmembers.swift
./validation-test/compiler_crashers_fixed/26968-swift-typechecker-isdeclavailable.swift
./validation-test/compiler_crashers_fixed/00743-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/00345-vtable.swift
./validation-test/compiler_crashers_fixed/00988-swift-typechecker-typecheckdecl.swift
./validation-test/compiler_crashers_fixed/27031-swift-genericparamlist-addnestedarchetypes.swift
./validation-test/compiler_crashers_fixed/01620-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/25775-void.swift
./validation-test/compiler_crashers_fixed/25796-swift-removeshadoweddecls.swift
./validation-test/compiler_crashers_fixed/25887-swift-funcdecl-funcdecl.swift
./validation-test/compiler_crashers_fixed/21852-swift-constraints-constraintsystem-opengeneric.swift
./validation-test/compiler_crashers_fixed/00057-get-type-of-member-reference.swift
./validation-test/compiler_crashers_fixed/25520-swift-typechecker-checkinheritanceclause.swift
./validation-test/compiler_crashers_fixed/00924-swift-parser-consumetoken.swift
./validation-test/compiler_crashers_fixed/27426-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/00680-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/00796-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/28006-swift-typechecker-resolveidentifiertype.swift
./validation-test/compiler_crashers_fixed/26534-swift-modulefile-getdecl.swift
./validation-test/compiler_crashers_fixed/25533-bool.swift
./validation-test/compiler_crashers_fixed/26270-swift-genericfunctiontype-get.swift
./validation-test/compiler_crashers_fixed/28197-swift-typebase-getdesugaredtype.swift
./validation-test/compiler_crashers_fixed/26059-std-function-func-mapsignaturetype.swift
./validation-test/compiler_crashers_fixed/28519-conformance-must-conform-to-literal-protocol.swift
./validation-test/compiler_crashers_fixed/26943-swift-typebase-getsuperclass.swift
./validation-test/compiler_crashers_fixed/00855-swift-parser-parsetypesimple.swift
./validation-test/compiler_crashers_fixed/27809-void.swift
./validation-test/compiler_crashers_fixed/25680-swift-conformancelookuptable-lookupconformances.swift
./validation-test/compiler_crashers_fixed/27160-swift-classtype-get.swift
./validation-test/compiler_crashers_fixed/02082-swift-clangmoduleunit-getimportedmodules.swift
./validation-test/compiler_crashers_fixed/00140-swift-nominaltypedecl-computetype.swift
./validation-test/compiler_crashers_fixed/00939-swift-typechecker-typecheckpattern.swift
./validation-test/compiler_crashers_fixed/01811-swift-modulefile-maybereadgenericparams.swift
./validation-test/compiler_crashers_fixed/02232-swift-parser-parsedaccessors-record.swift
./validation-test/compiler_crashers_fixed/01365-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/00778-swift-dependentmembertype-get.swift
./validation-test/compiler_crashers_fixed/02216-swift-archetypetype-setnestedtypes.swift
./validation-test/compiler_crashers_fixed/25441-swift-modulefile-gettype.swift
./validation-test/compiler_crashers_fixed/01534-bool.swift
./validation-test/compiler_crashers_fixed/01125-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/25702-swift-lexer-leximpl.swift
./validation-test/compiler_crashers_fixed/00559-void.swift
./validation-test/compiler_crashers_fixed/27696-swift-constraints-constraintsystem-matchtypes.swift
./validation-test/compiler_crashers_fixed/02097-swift-singlerawcomment-singlerawcomment.swift
./validation-test/compiler_crashers_fixed/01772-void.swift
./validation-test/compiler_crashers_fixed/00298-vtable.swift
./validation-test/compiler_crashers_fixed/27536-swift-namelookup-findlocalval-visitbracestmt.swift
./validation-test/compiler_crashers_fixed/01184-swift-lexer-lexidentifier.swift
./validation-test/compiler_crashers_fixed/27021-swift-constraints-constraintgraph-removeconstraint.swift
./validation-test/compiler_crashers_fixed/22582-swift-clangmoduleunit-getimportedmodules.swift
./validation-test/compiler_crashers_fixed/00701-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/25731-firsttarget.swift
./validation-test/compiler_crashers_fixed/00158-swift-streamprinter-printtext.swift
./validation-test/compiler_crashers_fixed/27606-swift-astcontext-addedexternaldecl.swift
./validation-test/compiler_crashers_fixed/25736-swift-lexer-lexidentifier.swift
./validation-test/compiler_crashers_fixed/01238-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/01633-swift-genericfunctiontype-get.swift
./validation-test/compiler_crashers_fixed/28785-membertype-received-null-dependent-member-type.swift
./validation-test/compiler_crashers_fixed/28793-nestedpabyname-didnt-find-the-associated-type-we-wanted.swift
./validation-test/compiler_crashers_fixed/09354-swift-nominaltypedecl-computetype.swift
./validation-test/compiler_crashers_fixed/27910-swift-conformancelookuptable-updatelookuptable.swift
./validation-test/compiler_crashers_fixed/02229-swift-parser-parsedeclextension.swift
./validation-test/compiler_crashers_fixed/26885-swift-constraints-constraintgraph-removeconstraint.swift
./validation-test/compiler_crashers_fixed/02017-swift-astcontext-getdictionarydecl.swift
./validation-test/compiler_crashers_fixed/27988-swift-inflightdiagnostic-fixitreplacechars.swift
./validation-test/compiler_crashers_fixed/00241-swift-lowering-typeconverter-getconstantinfo.swift
./validation-test/compiler_crashers_fixed/02020-swift-lexer-getlocforendoftoken.swift
./validation-test/compiler_crashers_fixed/00669-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/27246-swift-genericsignature-get.swift
./validation-test/compiler_crashers_fixed/25879-swift-sourcefile-getcache.swift
./validation-test/compiler_crashers_fixed/00590-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/26921-swift-typechecker-overapproximateosversionsatlocation.swift
./validation-test/compiler_crashers_fixed/27223-swift-typechecker-checkinheritanceclause.swift
./validation-test/compiler_crashers_fixed/00453-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/01434-std-function-func-swift-typebase-gettypevariables.swift
./validation-test/compiler_crashers_fixed/00260-swift-declname-printpretty.random.swift
./validation-test/compiler_crashers_fixed/01325-swift-typebase-isequal.swift
./validation-test/compiler_crashers_fixed/26395-swift-archetypebuilder-potentialarchetype-getarchetypeanchor.swift
./validation-test/compiler_crashers_fixed/27082-swift-constraints-constraintgraph-addconstraint.swift
./validation-test/compiler_crashers_fixed/27634-swift-lexer-kindofidentifier.swift
./validation-test/compiler_crashers_fixed/28413-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/01315-swift-parser-parsebraceitems.swift
./validation-test/compiler_crashers_fixed/28534-swift-unqualifiedlookup-unqualifiedlookup-swift-declname-swift-declcontext-swift.swift
./validation-test/compiler_crashers_fixed/26766-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/28079-swift-lexer-leximpl.swift
./validation-test/compiler_crashers_fixed/00093-swift-boundgenerictype-get.swift
./validation-test/compiler_crashers_fixed/01020-swift-lexer-lexoperatoridentifier.swift
./validation-test/compiler_crashers_fixed/25891-swift-type-print.swift
./validation-test/compiler_crashers_fixed/00066-diagnoseunknowntype.swift
./validation-test/compiler_crashers_fixed/00049-swift-nominaltypedecl-getmembers.swift
./validation-test/compiler_crashers_fixed/01353-swift-streamprinter-printtext.swift
./validation-test/compiler_crashers_fixed/00351-swift-typechecker-checksubstitutions.swift
./validation-test/compiler_crashers_fixed/00124-swift-genericfunctiontype-get.swift
./validation-test/compiler_crashers_fixed/26416-swift-parser-parsedecl.swift
./validation-test/compiler_crashers_fixed/26272-swift-modulefile-gettype.swift
./validation-test/compiler_crashers_fixed/02185-swift-constraints-constraintsystem-matchtypes.swift
./validation-test/compiler_crashers_fixed/01180-swift-nominaltypedecl-preparelookuptable.swift
./validation-test/compiler_crashers_fixed/28777-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/27284-swift-associatedtypedecl-associatedtypedecl.swift
./validation-test/compiler_crashers_fixed/28296-swift-genericsignature-getsubstitutionmap.swift
./validation-test/compiler_crashers_fixed/27088-swift-modulefile-gettype.swift
./validation-test/compiler_crashers_fixed/01411-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/28770-selfty-isequal-proto-getselfinterfacetype.swift
./validation-test/compiler_crashers_fixed/26999-swift-genericsignature-profile.swift
./validation-test/compiler_crashers_fixed/01356-swift-type-transform.swift
./validation-test/compiler_crashers_fixed/26804-swift-conformancelookuptable-lookupconformance.swift
./validation-test/compiler_crashers_fixed/26961-llvm-foldingset-swift-classtype-nodeequals.swift
./validation-test/compiler_crashers_fixed/27714-llvm-optional-swift-diagnostic-operator.swift
./validation-test/compiler_crashers_fixed/00209-swift-parser-parseclosuresignatureifpresent.swift
./validation-test/compiler_crashers_fixed/26102-swift-typechecker-overapproximateosversionsatlocation.swift
./validation-test/compiler_crashers_fixed/00160-swift-substitutedtype-get.swift
./validation-test/compiler_crashers_fixed/00051-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/27353-void.swift
./validation-test/compiler_crashers_fixed/00157-swift-sourcefile-getcache.swift
./validation-test/compiler_crashers_fixed/25927-swift-modulefile-loadextensions.swift
./validation-test/compiler_crashers_fixed/09990-std-function-func-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/27657-llvm-foldingset-swift-boundgenerictype-nodeequals.swift
./validation-test/compiler_crashers_fixed/26158-swift-parser-parsetypeattribute.swift
./validation-test/compiler_crashers_fixed/28857-nestedpabyname-didnt-find-the-associated-type-we-wanted.swift
./validation-test/compiler_crashers_fixed/01790-swift-constraints-constraintgraph-unbindtypevariable.swift
./validation-test/compiler_crashers_fixed/00428-getcallerdefaultarg.swift
./validation-test/compiler_crashers_fixed/00481-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/27119-void.swift
./validation-test/compiler_crashers_fixed/01010-swift-modulefile-gettype.swift
./validation-test/compiler_crashers_fixed/28577-isa-x-val-cast-ty-argument-of-incompatible-type.swift
./validation-test/compiler_crashers_fixed/01088-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/25777-swift-modulefile-gettype.swift
./validation-test/compiler_crashers_fixed/01420-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/26306-llvm-stringmapimpl-lookupbucketfor.swift
./validation-test/compiler_crashers_fixed/01592-swift-pattern-foreachvariable.swift
./validation-test/compiler_crashers_fixed/26146-swift-genericsignature-genericsignature.swift
./validation-test/compiler_crashers_fixed/27511-swift-constraints-constraintsystem-performmemberlookup.swift
./validation-test/compiler_crashers_fixed/01614-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/00916-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/26208-swift-modulefile-getdecl.swift
./validation-test/compiler_crashers_fixed/00508-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/25360-swift-lexer-getlocforendoftoken.swift
./validation-test/compiler_crashers_fixed/27961-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/26790-swift-type-getstring.swift
./validation-test/compiler_crashers_fixed/27784-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/01951-swift-constraints-constraintsystem-assignfixedtype.swift
./validation-test/compiler_crashers_fixed/28375-swift-typechecker-lookupmembertype.swift
./validation-test/compiler_crashers_fixed/00071-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/26077-swift-diagnosticengine-emitdiagnostic.swift
./validation-test/compiler_crashers_fixed/28667-result-case-not-implemented.swift
./validation-test/compiler_crashers_fixed/00654-swift-declcontext-lookupqualified.swift
./validation-test/compiler_crashers_fixed/26710-swift-constraints-constraintsystem-computeassigndesttype.swift
./validation-test/compiler_crashers_fixed/00461-swift-clangmoduleunit-getadaptermodule.swift
./validation-test/compiler_crashers_fixed/00542-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/25936-swift-conformancelookuptable-getimplicitprotocols.swift
./validation-test/compiler_crashers_fixed/00698-swift-type-transform.swift
./validation-test/compiler_crashers_fixed/02068-swift-parser-parsedeclfunc.swift
./validation-test/compiler_crashers_fixed/27159-swift-protocoldecl-existentialconformstoselfslow.swift
./validation-test/compiler_crashers_fixed/26820-swift-constraints-constraintsystem-opengeneric.swift
./validation-test/compiler_crashers_fixed/00798-swift-typechecker-coercepatterntotype.swift
./validation-test/compiler_crashers_fixed/25868-swift-synthesizematerializeforset.swift
./validation-test/compiler_crashers_fixed/27458-swift-constraints-constraintsystem-solve.swift
./validation-test/compiler_crashers_fixed/00084-std-function-func-swift-archetypebuilder-maptypeintocontext.swift
./validation-test/compiler_crashers_fixed/25856-swift-typechecker-validategenericfuncsignature.swift
./validation-test/compiler_crashers_fixed/01958-std-function-func-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/24987-swift-expr-findexistinginitializercontext.swift
./validation-test/compiler_crashers_fixed/00402-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/01368-llvm-ondiskchainedhashtable-swift-modulefile-decltableinfo-find.swift
./validation-test/compiler_crashers_fixed/28080-swift-parser-diagnose.swift
./validation-test/compiler_crashers_fixed/01647-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/26996-swift-classtype-get.swift
./validation-test/compiler_crashers_fixed/26187-void.swift
./validation-test/compiler_crashers_fixed/00282-malloc-zone-malloc.swift
./validation-test/compiler_crashers_fixed/00877-as.swift
./validation-test/compiler_crashers_fixed/28033-swift-configureconstructortype.swift
./validation-test/compiler_crashers_fixed/27190-swift-typechecker-checkunsupportedprotocoltype.swift
./validation-test/compiler_crashers_fixed/26684-swift-arrayexpr-create.swift
./validation-test/compiler_crashers_fixed/00659-s.swift
./validation-test/compiler_crashers_fixed/28065-swift-constraints-constraintsystem-mergeequivalenceclasses.swift
./validation-test/compiler_crashers_fixed/26257-swift-functiontype-get.swift
./validation-test/compiler_crashers_fixed/01303-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/00197-swift-performstmtdiagnostics.swift
./validation-test/compiler_crashers_fixed/28550-unreachable-executed-at-swift-include-swift-ast-typevisitor-h-39.swift
./validation-test/compiler_crashers_fixed/01243-llvm-smallvectorimpl-swift-diagnosticargument-operator.swift
./validation-test/compiler_crashers_fixed/01777-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/26495-swift-typechecker-getinterfacetypefrominternaltype.swift
./validation-test/compiler_crashers_fixed/27375-swift-unqualifiedlookup-unqualifiedlookup.swift
./validation-test/compiler_crashers_fixed/27287-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/00650-szone-malloc-should-clear.swift
./validation-test/compiler_crashers_fixed/00833-clang-declvisitor-base-clang-declvisitor-make-const-ptr.swift
./validation-test/compiler_crashers_fixed/28390-swift-expr-walk.swift
./validation-test/compiler_crashers_fixed/00164-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/01427-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/25725-llvm-bitstreamcursor-read.swift
./validation-test/compiler_crashers_fixed/02063-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/26080-swift-tuplepattern-create.swift
./validation-test/compiler_crashers_fixed/26891-vtable.swift
./validation-test/compiler_crashers_fixed/01857-std-function-func-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/26892-swift-diagnosticengine-emitdiagnostic.swift
./validation-test/compiler_crashers_fixed/28803-swift-typebase-getdesugaredtype.swift
./validation-test/compiler_crashers_fixed/01630-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/26960-void.swift
./validation-test/compiler_crashers_fixed/27593-swift-genericparamlist-deriveallarchetypes.swift
./validation-test/compiler_crashers_fixed/27285-swift-typechecker-resolvetypeincontext.swift
./validation-test/compiler_crashers_fixed/25748-swift-patternbindingdecl-hasstorage.swift
./validation-test/compiler_crashers_fixed/27377-swift-typechecker-isdeclavailable.swift
./validation-test/compiler_crashers_fixed/27418-swift-typechecker-lookupmember.swift
./validation-test/compiler_crashers_fixed/27049-swift-markasobjc.swift
./validation-test/compiler_crashers_fixed/27166-swift-typebase-isspecialized.swift
./validation-test/compiler_crashers_fixed/26229-swift-astcontext-allocate.swift
./validation-test/compiler_crashers_fixed/27140-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/28839-genericsig.swift
./validation-test/compiler_crashers_fixed/01261-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/26420-swift-astcontext-getidentifier.swift
./validation-test/compiler_crashers_fixed/01590-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/25439-swift-conformancelookuptable-addprotocol.swift
./validation-test/compiler_crashers_fixed/27127-swift-constraints-constraintgraph-change-undo.swift
./validation-test/compiler_crashers_fixed/25455-swift-typechecker-coercepatterntotype.swift
./validation-test/compiler_crashers_fixed/26541-swift-lexer-lexstringliteral.swift
./validation-test/compiler_crashers_fixed/26095-swift-generictypeparamtype-get.swift
./validation-test/compiler_crashers_fixed/25717-swift-lexer-lexidentifier.swift
./validation-test/compiler_crashers_fixed/27288-swift-typechecker-getinterfacetypefrominternaltype.swift
./validation-test/compiler_crashers_fixed/28151-swift-constraints-constraintsystem-simplifymemberconstraint.swift
./validation-test/compiler_crashers_fixed/01317-swift-modulefile-maybereadgenericparams.swift
./validation-test/compiler_crashers_fixed/00839-swift-diagnosticengine-flushactivediagnostic.swift
./validation-test/compiler_crashers_fixed/00523-swift-typevisitor.swift
./validation-test/compiler_crashers_fixed/01701-swift-constraints-constraintsystem-getfixedtyperecursive.swift
./validation-test/compiler_crashers_fixed/28568-result-case-not-implemented.swift
./validation-test/compiler_crashers_fixed/27916-swift-sourcemanager-getmessage.swift
./validation-test/compiler_crashers_fixed/28318-swift-constraints-constraintgraphnode-getmembertype.swift
./validation-test/compiler_crashers_fixed/25754-swift-astcontext-getconformance.swift
./validation-test/compiler_crashers_fixed/01642-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/26521-swift-modulefile-getdeclcontext.swift
./validation-test/compiler_crashers_fixed/28837-swift-protocolcompositiontype-get-swift-astcontext-const-llvm-arrayref-swift-typ.swift
./validation-test/compiler_crashers_fixed/27430-swift-boundgenerictype-getsubstitutions.swift
./validation-test/compiler_crashers_fixed/25433-swift-archetypebuilder-finalize.swift
./validation-test/compiler_crashers_fixed/27599-llvm-foldingset-swift-boundgenerictype-nodeequals.swift
./validation-test/compiler_crashers_fixed/00891-a.swift
./validation-test/compiler_crashers_fixed/26431-swift-genericparamlist-deriveallarchetypes.swift
./validation-test/compiler_crashers_fixed/25391-swift-archetypebuilder-potentialarchetype-gettype.swift
./validation-test/compiler_crashers_fixed/25402-swift-archetypebuilder-finalize.swift
./validation-test/compiler_crashers_fixed/25542-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/26350-swift-lexer-kindofidentifier.swift
./validation-test/compiler_crashers_fixed/26982-swift-nominaltypedecl-getmembers.swift
./validation-test/compiler_crashers_fixed/00447-swift-typechecker-checksubstitutions.swift
./validation-test/compiler_crashers_fixed/28117-resolveidenttypecomponent.swift
./validation-test/compiler_crashers_fixed/01421-void.swift
./validation-test/compiler_crashers_fixed/25620-swift-inflightdiagnostic-fixitreplacechars.swift
./validation-test/compiler_crashers_fixed/26263-swift-protocoltype-canonicalizeprotocols.swift
./validation-test/compiler_crashers_fixed/27753-std-function-func-setboundvarstypeerror.swift
./validation-test/compiler_crashers_fixed/25947-llvm-tinyptrvector-swift-valuedecl-push-back.swift
./validation-test/compiler_crashers_fixed/26959-std-function-func-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/26216-swift-parser-parsebraceitems.swift
./validation-test/compiler_crashers_fixed/28783-hasconformanceinsignature-inprotocol-getrequirementsignature-subjecttype-conform.swift
./validation-test/compiler_crashers_fixed/25943-swift-boundgenerictype-get.swift
./validation-test/compiler_crashers_fixed/27688-swift-vardecl-isanonclosureparam.swift
./validation-test/compiler_crashers_fixed/01993-swift-typechecker-checksubstitutions.swift
./validation-test/compiler_crashers_fixed/25973-swift-parser-skipsingle.swift
./validation-test/compiler_crashers_fixed/00377-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/26573-swift-parser-parseanyidentifier.swift
./validation-test/compiler_crashers_fixed/27136-swift-constructordecl-setbodyparams.swift
./validation-test/compiler_crashers_fixed/00730-swift-modulefile-maybereadgenericparams.swift
./validation-test/compiler_crashers_fixed/26341-swift-unqualifiedlookup-unqualifiedlookup.swift
./validation-test/compiler_crashers_fixed/25785-swift-modulefile-gettype.swift
./validation-test/compiler_crashers_fixed/26196-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/28703-swift-typebase-getdesugaredtype.swift
./validation-test/compiler_crashers_fixed/27294-swift-existentialmetatypetype-get.swift
./validation-test/compiler_crashers_fixed/00599-swift-clangmoduleunit-getimportedmodules.swift
./validation-test/compiler_crashers_fixed/25743-swift-genericparamlist-create.swift
./validation-test/compiler_crashers_fixed/01822-swift-typebase-isspecialized.swift
./validation-test/compiler_crashers_fixed/01621-swift-completegenerictyperesolver-resolvedependentmembertype.swift
./validation-test/compiler_crashers_fixed/27370-swift-constraints-constraintsystem-getconstraintlocator.swift
./validation-test/compiler_crashers_fixed/00309-llvm-prettystacktraceentry-prettystacktraceentry.swift
./validation-test/compiler_crashers_fixed/01728-llvm-foldingset-swift-tupletype-nodeequals.swift
./validation-test/compiler_crashers_fixed/00102-swift-constraints-constraintsystem-assignfixedtype.swift
./validation-test/compiler_crashers_fixed/27465-swift-constraints-constraintsystem-addtypevariableconstraintstoworklist.swift
./validation-test/compiler_crashers_fixed/01127-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/25684-swift-typebase-isspecialized.swift
./validation-test/compiler_crashers_fixed/28201-swift-typechecker-resolvetypewitness.swift
./validation-test/compiler_crashers_fixed/24440-swift-typechecker-coercepatterntotype.swift
./validation-test/compiler_crashers_fixed/00787-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/02055-llvm-foldingsetnodeid-operator.swift
./validation-test/compiler_crashers_fixed/01855-swift-pattern-foreachvariable.swift
./validation-test/compiler_crashers_fixed/01200-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/26918-swift-constraints-constraintlocator-profile.swift
./validation-test/compiler_crashers_fixed/01247-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/28448-dist-nested-type-should-have-matched-associated-type-failed.swift
./validation-test/compiler_crashers_fixed/00953-swift-inflightdiagnostic-highlight.swift
./validation-test/compiler_crashers_fixed/01825-swift-module-lookupvalue.swift
./validation-test/compiler_crashers_fixed/02245-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/25858-swift-nominaltypedecl-computeinterfacetype.swift
./validation-test/compiler_crashers_fixed/01178-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/06542-swift-unqualifiedlookup-unqualifiedlookup.swift
./validation-test/compiler_crashers_fixed/25911-swift-valuedecl-setinterfacetype.swift
./validation-test/compiler_crashers_fixed/01765-swift-inflightdiagnostic-highlight.swift
./validation-test/compiler_crashers_fixed/00336-swift-parser-parsetoplevelcodedecldelayed.swift
./validation-test/compiler_crashers_fixed/00422-void.swift
./validation-test/compiler_crashers_fixed/25810-swift-astprinter-printtextimpl.swift
./validation-test/compiler_crashers_fixed/26761-swift-constraints-constraintsystem-solvesimplified.swift
./validation-test/compiler_crashers_fixed/26789-swift-lexer-lexidentifier.swift
./validation-test/compiler_crashers_fixed/27042-swift-conformancelookuptable-expandimpliedconformances.swift
./validation-test/compiler_crashers_fixed/25704-vtable.swift
./validation-test/compiler_crashers_fixed/00964-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/27975-swift-genericsignature-get.swift
./validation-test/compiler_crashers_fixed/01745-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/26910-swift-type-transform.swift
./validation-test/compiler_crashers_fixed/01185-swift-parser-parsetypeidentifier.swift
./validation-test/compiler_crashers_fixed/01807-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/27936-swift-structtype-get.swift
./validation-test/compiler_crashers_fixed/27516-swift-nominaltypedecl-classifyasoptionaltype.swift
./validation-test/compiler_crashers_fixed/25928-swift-parser-skipsingle.swift
./validation-test/compiler_crashers_fixed/25457-std-function-func-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/01510-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/28635-swift-tupletype-get-llvm-arrayref-swift-tupletypeelt-swift-astcontext-const.swift
./validation-test/compiler_crashers_fixed/00268-swift-typechecker-typecheckexpression.swift
./validation-test/compiler_crashers_fixed/27650-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/00404-swift-constraints-constraintsystem-getfixedtyperecursive.swift
./validation-test/compiler_crashers_fixed/26817-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/25883-swift-constraints-simplifylocator.swift
./validation-test/compiler_crashers_fixed/27297-llvm-bitstreamcursor-readrecord.swift
./validation-test/compiler_crashers_fixed/26307-swift-parser-isstartofdecl.swift
./validation-test/compiler_crashers_fixed/01479-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/26076-swift-parser-skipsingle.swift
./validation-test/compiler_crashers_fixed/27265-resolveidenttypecomponent.swift
./validation-test/compiler_crashers_fixed/00581-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/01110-swift-archetypetype-getnestedtype.swift
./validation-test/compiler_crashers_fixed/26165-swift-diagnosticengine-emitdiagnostic.swift
./validation-test/compiler_crashers_fixed/01225-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/01318-swift-constraints-constraintgraph-addconstraint.swift
./validation-test/compiler_crashers_fixed/25470-swift-typechecker-checkdeclarationavailability.swift
./validation-test/compiler_crashers_fixed/26097-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/01870-swift-protocoltype-canonicalizeprotocols.swift
./validation-test/compiler_crashers_fixed/28699-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/28860-iscomplete-isinvalid-conformance-already-complete.swift
./validation-test/compiler_crashers_fixed/26527-swift-parser-isstartofdecl.swift
./validation-test/compiler_crashers_fixed/24915-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/02205-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/02141-swift-parser-skipsingle.swift
./validation-test/compiler_crashers_fixed/28733-parent-parent-is-nominaltype-parent-is-boundgenerictype-parent-is-unboundgeneric.swift
./validation-test/compiler_crashers_fixed/28850-unreachable-executed-at-swift-lib-sema-typecheckgeneric-cpp-220.swift
./validation-test/compiler_crashers_fixed/28328-swift-typebase-getdesugaredtype.swift
./validation-test/compiler_crashers_fixed/01654-swift-astprinter-printname.swift
./validation-test/compiler_crashers_fixed/28364-swift-typechecker-addimplicitconstructors.swift
./validation-test/compiler_crashers_fixed/27955-swift-declattribute-print.swift
./validation-test/compiler_crashers_fixed/00937-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/00317-swift-typebase-gettypeofmember.swift
./validation-test/compiler_crashers_fixed/01181-swift-unqualifiedlookup-unqualifiedlookup.swift
./validation-test/compiler_crashers_fixed/00611-swift-constraints-constraintsystem-opengeneric.swift
./validation-test/compiler_crashers_fixed/00498-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/27332-swift-constraints-constraintsystem-simplifytype.swift
./validation-test/compiler_crashers_fixed/00947-void.swift
./validation-test/compiler_crashers_fixed/02117-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/25835-swift-genericsignature-profile.swift
./validation-test/compiler_crashers_fixed/25576-swift-serialization-serializer-writeblockinfoblock.swift
./validation-test/compiler_crashers_fixed/28194-swift-abstractstoragedecl-isgettermutating.swift
./validation-test/compiler_crashers_fixed/02125-swift-completegenerictyperesolver-resolvedependentmembertype.swift
./validation-test/compiler_crashers_fixed/00242-swift-lowering-silgenfunction-emitclosurevalue.swift
./validation-test/compiler_crashers_fixed/00585-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/25406-swift-functiontype-get.swift
./validation-test/compiler_crashers_fixed/28624-swift-type-transform-llvm-function-ref-swift-type-swift-type-const.swift
./validation-test/compiler_crashers_fixed/28585-anonymous-namespace-verifier-walktostmtpost-swift-stmt.swift
./validation-test/compiler_crashers_fixed/01753-swift-lexer-lexstringliteral.swift
./validation-test/compiler_crashers_fixed/28840-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/00591-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/01773-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/26164-std-function-func-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/25938-swift-typechecker-checkdeclarationavailability.swift
./validation-test/compiler_crashers_fixed/00734-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/01536-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/25956-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/27373-swift-conformancelookuptable-lookupconformances.swift
./validation-test/compiler_crashers_fixed/25960-std-function-func-setboundvarstypeerror.swift
./validation-test/compiler_crashers_fixed/27546-swift-clangimporter-lookupvalue.swift
./validation-test/compiler_crashers_fixed/28077-swift-parser-parsedeclsubscript.swift
./validation-test/compiler_crashers_fixed/00699-swift-modulefile-lookupvalue.swift
./validation-test/compiler_crashers_fixed/00986-swift-unboundgenerictype-get.swift
./validation-test/compiler_crashers_fixed/27366-swift-type-transform.swift
./validation-test/compiler_crashers_fixed/00304-swift-tuplepattern-create.swift
./validation-test/compiler_crashers_fixed/26365-swift-constraints-constraintgraph-gatherconstraints.swift
./validation-test/compiler_crashers_fixed/28616-swift-parser-parseexprsequence-swift-diag-bool-bool.swift
./validation-test/compiler_crashers_fixed/26962-swift-typechecker-validategenericfuncsignature.swift
./validation-test/compiler_crashers_fixed/01086-swift-parser-parseexprpostfix.swift
./validation-test/compiler_crashers_fixed/25574-llvm-foldingset-swift-declname-compounddeclname-nodeequals.swift
./validation-test/compiler_crashers_fixed/26816-checkenumrawvalues.swift
./validation-test/compiler_crashers_fixed/01018-diagnoseunknowntype.swift
./validation-test/compiler_crashers_fixed/26981-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/00733-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/25544-llvm-foldingset-swift-tupletype-nodeequals.swift
./validation-test/compiler_crashers_fixed/26888-swift-nominaltypedecl-preparelookuptable.swift
./validation-test/compiler_crashers_fixed/27971-swift-constraints-constraintsystem-applysolution.swift
./validation-test/compiler_crashers_fixed/28141-swift-typechecker-addimplicitconstructors.swift
./validation-test/compiler_crashers_fixed/00753-swift-type-transform.swift
./validation-test/compiler_crashers_fixed/02012-inferdynamic.swift
./validation-test/compiler_crashers_fixed/01847-std-function-func-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/27722-swift-removeshadoweddecls.swift
./validation-test/compiler_crashers_fixed/26443-swift-parser-parsedeclvar.swift
./validation-test/compiler_crashers_fixed/01973-void.swift
./validation-test/compiler_crashers_fixed/28740-unreachable-executed-at-swift-lib-ast-astcontext-cpp-1324.swift
./validation-test/compiler_crashers_fixed/27938-swift-arrayexpr-create.swift
./validation-test/compiler_crashers_fixed/27485-swift-bracestmt-create.swift
./validation-test/compiler_crashers_fixed/01528-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/00776-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/27260-swift-constraints-constraintlocator-profile.swift
./validation-test/compiler_crashers_fixed/01725-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/25908-swift-constraints-solution-computesubstitutions.swift
./validation-test/compiler_crashers_fixed/26757-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/26505-llvm-foldingset-swift-classtype-nodeequals.swift
./validation-test/compiler_crashers_fixed/01694-void.swift
./validation-test/compiler_crashers_fixed/25859-swift-tupletype-get.swift
./validation-test/compiler_crashers_fixed/26128-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/26051-swift-diagnosticengine-emitdiagnostic.swift
./validation-test/compiler_crashers_fixed/01836-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/01118-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/27383-swift-declcontext-lookupqualified.swift
./validation-test/compiler_crashers_fixed/01487-std-function-func-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/26702-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/01685-swift-typebase-getanyoptionalobjecttype.swift
./validation-test/compiler_crashers_fixed/26645-swift-functiontype-get.swift
./validation-test/compiler_crashers_fixed/02013-swift-lexer-leximpl.swift
./validation-test/compiler_crashers_fixed/02147-swift-diagnosticengine-diagnose.swift
./validation-test/compiler_crashers_fixed/26748-swift-constraints-constraintsystem-recordfix.swift
./validation-test/compiler_crashers_fixed/00946-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/00842-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/28044-swift-completegenerictyperesolver-resolvegenerictypeparamtype.swift
./validation-test/compiler_crashers_fixed/00945-swift-lexer-lexstringliteral.swift
./validation-test/compiler_crashers_fixed/27076-swift-declcontext-getlocalconformances.swift
./validation-test/compiler_crashers_fixed/27329-llvm-foldingset-swift-classtype-nodeequals.swift
./validation-test/compiler_crashers_fixed/27337-swift-valuedecl-overwritetype.swift
./validation-test/compiler_crashers_fixed/02223-swift-lexer-leximpl.swift
./validation-test/compiler_crashers_fixed/25768-swift-parser-parseexprcallsuffix.swift
./validation-test/compiler_crashers_fixed/27858-swift-inouttype-get.swift
./validation-test/compiler_crashers_fixed/28365-swift-constraints-constraintgraphnode-getmembertype.swift
./validation-test/compiler_crashers_fixed/01789-swift-generictypeparamtype-get.swift
./validation-test/compiler_crashers_fixed/00522-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/01051-swift-declcontext-lookupqualified.swift
./validation-test/compiler_crashers_fixed/26286-swift-modulefile-gettype.swift
./validation-test/compiler_crashers_fixed/02227-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/01813-swift-archetypebuilder-resolvearchetype.swift
./validation-test/compiler_crashers_fixed/27530-resolveidenttypecomponent.swift
./validation-test/compiler_crashers_fixed/27715-swift-constraints-constraintsystem-matchtypes.swift
./validation-test/compiler_crashers_fixed/00831-x.swift
./validation-test/compiler_crashers_fixed/26248-swift-generictypeparamtype-get.swift
./validation-test/compiler_crashers_fixed/26547-swift-sourcefile-lookupcache-lookupvalue.swift
./validation-test/compiler_crashers_fixed/27694-swift-nominaltypedecl-preparelookuptable.swift
./validation-test/compiler_crashers_fixed/00804-llvm-ondiskchainedhashtable-swift-modulefile-decltableinfo-find.swift
./validation-test/compiler_crashers_fixed/01055-swift-tupletype-get.swift
./validation-test/compiler_crashers_fixed/01588-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/00333-swift-objcattr-createunnamedimplicit.swift
./validation-test/compiler_crashers_fixed/28499-start-isvalid-end-isvalid-start-and-end-should-either-both-be-valid-or-both-be-i.swift
./validation-test/compiler_crashers_fixed/26205-swift-lexer-leximpl.swift
./validation-test/compiler_crashers_fixed/02210-swift-typechecker-coercepatterntotype.swift
./validation-test/compiler_crashers_fixed/28488-conforms-replacement-haserror-isopenedanyobject-replacement-replacement-is-gener.swift
./validation-test/compiler_crashers_fixed/00181-swift-parser-parseexprclosure.swift
./validation-test/compiler_crashers_fixed/28361-swift-archetypebuilder-maptypeintocontext.swift
./validation-test/compiler_crashers_fixed/01294-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/26569-swift-constraints-constraintsystem-optimizeconstraints.swift
./validation-test/compiler_crashers_fixed/26913-swift-markasobjc.swift
./validation-test/compiler_crashers_fixed/25519-void.swift
./validation-test/compiler_crashers_fixed/00728-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/28294-swift-archetypebuilder-addsuperclassrequirement.swift
./validation-test/compiler_crashers_fixed/25834-llvm-smallvectorimpl-swift-decl-insert.swift
./validation-test/compiler_crashers_fixed/00279-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/28041-swift-typechecker-lookupunqualified.swift
./validation-test/compiler_crashers_fixed/26578-swift-expr-walk.swift
./validation-test/compiler_crashers_fixed/28198-swift-typerepr-walk.swift
./validation-test/compiler_crashers_fixed/25536-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/02048-swift-enumdecl-issimpleenum.swift
./validation-test/compiler_crashers_fixed/00754-x.swift
./validation-test/compiler_crashers_fixed/01430-swift-expr-getsourcerange.swift
./validation-test/compiler_crashers_fixed/01229-void.swift
./validation-test/compiler_crashers_fixed/26754-swift-abstractstoragedecl-setinvalidbracesrange.swift
./validation-test/compiler_crashers_fixed/28440-swift-typechecker-resolveidentifiertype.swift
./validation-test/compiler_crashers_fixed/27881-swift-declcontext-getlocalconformances.swift
./validation-test/compiler_crashers_fixed/01736-void.swift
./validation-test/compiler_crashers_fixed/26604-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/27561-swift-functiontype-get.swift
./validation-test/compiler_crashers_fixed/01475-swift-functiontype-get.swift
./validation-test/compiler_crashers_fixed/25965-firsttarget.swift
./validation-test/compiler_crashers_fixed/01994-swift-parser-consumetoken.swift
./validation-test/compiler_crashers_fixed/26976-swift-constraints-constraintsystem-opentype.swift
./validation-test/compiler_crashers_fixed/01507-swift-constraints-matchcallarguments.swift
./validation-test/compiler_crashers_fixed/01754-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/27891-swift-typechecker-resolvesuperclass.swift
./validation-test/compiler_crashers_fixed/02011-swift-lexer-lexidentifier.swift
./validation-test/compiler_crashers_fixed/25805-swift-genericparamlist-create.swift
./validation-test/compiler_crashers_fixed/25549-swift-constraints-constraintsystem-gettypeofreference.swift
./validation-test/compiler_crashers_fixed/26363-llvm-errs.swift
./validation-test/compiler_crashers_fixed/02179-llvm-bitstreamcursor-readrecord.swift
./validation-test/compiler_crashers_fixed/26890-swift-typechecker-isdeclavailable.swift
./validation-test/compiler_crashers_fixed/26700-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/28654-hastype-e-expected-type-to-have-been-set.swift
./validation-test/compiler_crashers_fixed/02257-swift-any-from-nsmutablearray.swift
./validation-test/compiler_crashers_fixed/25628-swift-genericsignature-get.swift
./validation-test/compiler_crashers_fixed/27462-swift-modulefile-lookupvalue.swift
./validation-test/compiler_crashers_fixed/00857-std-function-func-swift-constraints-constraintsystem-simplifytype.swift
./validation-test/compiler_crashers_fixed/27434-swift-parser-diagnose.swift
./validation-test/compiler_crashers_fixed/01969-getmemberforbasetype.swift
./validation-test/compiler_crashers_fixed/26483-swift-archetypebuilder-inferrequirementswalker-walktotypepost.swift
./validation-test/compiler_crashers_fixed/25861-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/01219-swift-modulefile-gettype.swift
./validation-test/compiler_crashers_fixed/02053-swift-modulefile-maybereadsubstitution.swift
./validation-test/compiler_crashers_fixed/28591-swift-constraints-constraintsystem-solvesimplified-llvm-smallvectorimpl-swift-co.swift
./validation-test/compiler_crashers_fixed/01730-swift-completegenerictyperesolver-resolvedependentmembertype.swift
./validation-test/compiler_crashers_fixed/00784-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/27216-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/27343-llvm-smallvectorimpl-swift-protocolconformance-operator.swift
./validation-test/compiler_crashers_fixed/00081-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/00854-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/01514-swift-optional-swift-diagnostic-operator.swift
./validation-test/compiler_crashers_fixed/27874-swift-enumtype-get.swift
./validation-test/compiler_crashers_fixed/01011-swift-modulefile-getimportedmodules.swift
./validation-test/compiler_crashers_fixed/26627-swift-lexer-lexoperatoridentifier.swift
./validation-test/compiler_crashers_fixed/00547-llvm-foldingset-swift-tupletype-nodeequals.swift
./validation-test/compiler_crashers_fixed/28421-swift-constraints-constraintsystem-diagnosefailureforexpr.swift
./validation-test/compiler_crashers_fixed/27849-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/00834-t.swift
./validation-test/compiler_crashers_fixed/00394-void.swift
./validation-test/compiler_crashers_fixed/26525-swift-modulefile-maybereadgenericparams.swift
./validation-test/compiler_crashers_fixed/26497-swift-diagnosticengine-emitdiagnostic.swift
./validation-test/compiler_crashers_fixed/27180-swift-constraints-constraintsystem-simplifytype.swift
./validation-test/compiler_crashers_fixed/28196-swift-constraints-constraintgraph-addconstraint.swift
./validation-test/compiler_crashers_fixed/26502-swift-protocoltype-canonicalizeprotocols.swift
./validation-test/compiler_crashers_fixed/25663-swift-concretedeclref-specializeddeclref-create.swift
./validation-test/compiler_crashers_fixed/27310-swift-modulefile-gettype.swift
./validation-test/compiler_crashers_fixed/26696-swift-genericparamlist-create.swift
./validation-test/compiler_crashers_fixed/01342-swift-parser-parsegetsetimpl.swift
./validation-test/compiler_crashers_fixed/28411-swift-typechecker-resolveidentifiertype.swift
./validation-test/compiler_crashers_fixed/02093-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/27028-swift-nominaltypedecl-preparelookuptable.swift
./validation-test/compiler_crashers_fixed/01840-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/26475-llvm-bitstreamcursor-read.swift
./validation-test/compiler_crashers_fixed/01882-swift-constraints-constraintsystem-simplifyconformstoconstraint.swift
./validation-test/compiler_crashers_fixed/00822-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/00726-swift-typechecker-resolvetypeincontext.swift
./validation-test/compiler_crashers_fixed/28592-objectty-is-lvaluetype-objectty-is-inouttype-cannot-have-inout-or-lvalue-wrapped.swift
./validation-test/compiler_crashers_fixed/26149-swift-boundgenerictype-get.swift
./validation-test/compiler_crashers_fixed/27734-swift-typechecker-coercepatterntotype.swift
./validation-test/compiler_crashers_fixed/25915-swift-typebase-getanyoptionalobjecttype.swift
./validation-test/compiler_crashers_fixed/27435-swift-constraints-solution-solution.swift
./validation-test/compiler_crashers_fixed/27547-swift-constraints-constraintsystem-getalternativeliteraltypes.swift
./validation-test/compiler_crashers_fixed/25390-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/27991-void.swift
./validation-test/compiler_crashers_fixed/28054-ldstninstinfo.swift
./validation-test/compiler_crashers_fixed/26666-swift-lexer-lexoperatoridentifier.swift
./validation-test/compiler_crashers_fixed/28338-swift-genericsignature-getsubstitutionmap.swift
./validation-test/compiler_crashers_fixed/28506-swift-iterativetypechecker-issatisfied-swift-typecheckrequest.swift
./validation-test/compiler_crashers_fixed/27241-swift-constraints-constraintsystem-recordopenedtypes.swift
./validation-test/compiler_crashers_fixed/00329-swift-parser-parsedeclfunc.swift
./validation-test/compiler_crashers_fixed/27771-swift-typebase-isequal.swift
./validation-test/compiler_crashers_fixed/02231-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/28512-anonymous-namespace-traversal-visit-swift-typerepr.swift
./validation-test/compiler_crashers_fixed/27055-swift-constraints-constraintgraph-computeconnectedcomponents.swift
./validation-test/compiler_crashers_fixed/26724-clang-declvisitor-base-clang-declvisitor-make-const-ptr.swift
./validation-test/compiler_crashers_fixed/26944-swift-astprinter-printtextimpl.swift
./validation-test/compiler_crashers_fixed/00437-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/25921-swift-valuedecl-getinterfacetype.swift
./validation-test/compiler_crashers_fixed/00207-swift-parser-parseexprcallsuffix.swift
./validation-test/compiler_crashers_fixed/27823-swift-parser-parsetoken.swift
./validation-test/compiler_crashers_fixed/27773-swift-typechecker-getinterfacetypefrominternaltype.swift
./validation-test/compiler_crashers_fixed/01946-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/27070-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/01764-swift-astprinter-printtextimpl.swift
./validation-test/compiler_crashers_fixed/00825-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/00745-swift-type-transform.swift
./validation-test/compiler_crashers_fixed/26971-swift-constraints-constraintsystem-solvesimplified.swift
./validation-test/compiler_crashers_fixed/25581-swift-protocoltype-canonicalizeprotocols.swift
./validation-test/compiler_crashers_fixed/00483-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/27565-swift-typechecker-checkinheritanceclause.swift
./validation-test/compiler_crashers_fixed/27666-swift-modulefile-loadextensions.swift
./validation-test/compiler_crashers_fixed/28790-conformance-getwitness-requirement-nullptr-getdecl-already-have-a-non-optional-w.swift
./validation-test/compiler_crashers_fixed/26697-swift-genericparamlist-deriveallarchetypes.swift
./validation-test/compiler_crashers_fixed/01046-swift-constraints-constraintsystem-simplify.swift
./validation-test/compiler_crashers_fixed/01771-swift-sourcefile-getcache.swift
./validation-test/compiler_crashers_fixed/01636-swift-tupletype-get.swift
./validation-test/compiler_crashers_fixed/01306-swift-type-transform.swift
./validation-test/compiler_crashers_fixed/26366-swift-nominaltypedecl-preparelookuptable.swift
./validation-test/compiler_crashers_fixed/26320-swift-modulefile-getimportedmodules.swift
./validation-test/compiler_crashers_fixed/27186-swift-diagnosticengine-emitdiagnostic.swift
./validation-test/compiler_crashers_fixed/01640-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/27015-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/00978-llvm-foldingset-swift-structtype-nodeequals.swift
./validation-test/compiler_crashers_fixed/00139-swift-typechecker-resolveidentifiertype.swift
./validation-test/compiler_crashers_fixed/00808-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/01899-swift-declcontext-lookupqualified.swift
./validation-test/compiler_crashers_fixed/27342-swift-constraints-constraintsystem-getfixedtyperecursive.swift
./validation-test/compiler_crashers_fixed/26613-swift-archetypebuilder-potentialarchetype-addconformance.swift
./validation-test/compiler_crashers_fixed/00406-swift-declcontext-lookupqualified.swift
./validation-test/compiler_crashers_fixed/26120-swift-removeshadoweddecls.swift
./validation-test/compiler_crashers_fixed/01556-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/26285-swift-parser-consumeidentifier.swift
./validation-test/compiler_crashers_fixed/00065-cerror.swift
./validation-test/compiler_crashers_fixed/00098-swift-constraints-constraintgraph-addconstraint.swift
./validation-test/compiler_crashers_fixed/26563-swift-constraints-constraintgraph-unbindtypevariable.swift
./validation-test/compiler_crashers_fixed/27048-swift-modulefile-getimportedmodules.swift
./validation-test/compiler_crashers_fixed/25540-swift-parser-parsedeclstruct.swift
./validation-test/compiler_crashers_fixed/00155-swift-protocoldecl-requiresclassslow.swift
./validation-test/compiler_crashers_fixed/26379-swift-astcontext-getidentifier.swift
./validation-test/compiler_crashers_fixed/27761-swift-archetypebuilder-addgenericsignature.swift
./validation-test/compiler_crashers_fixed/26830-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/01582-swift-constraints-solution-computesubstitutions.swift
./validation-test/compiler_crashers_fixed/27324-swift-constraints-constraintsystem-finalize.swift
./validation-test/compiler_crashers_fixed/02099-swift-clangimporter-loadmodule.swift
./validation-test/compiler_crashers_fixed/00966-swift-astprinter-printtextimpl.swift
./validation-test/compiler_crashers_fixed/27420-llvm-optional-swift-diagnostic-operator.swift
./validation-test/compiler_crashers_fixed/26876-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/28507-swift-typerepr-getsourcerange-const.swift
./validation-test/compiler_crashers_fixed/28016-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/25435-swift-valuedecl-setinterfacetype.swift
./validation-test/compiler_crashers_fixed/28492-isa-abstractfunctiondecl-dc-isa-fileunit-dc-unknown-declcontext.swift
./validation-test/compiler_crashers_fixed/27607-swift-constraints-constraintsystem-matchfunctiontypes.swift
./validation-test/compiler_crashers_fixed/00490-swift-diagnosticengine-flushactivediagnostic.swift
./validation-test/compiler_crashers_fixed/26328-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/00694-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/28243-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/27475-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/26079-swift-parser-parseexprpostfix.swift
./validation-test/compiler_crashers_fixed/23445-swift-constraints-constraintgraph-unbindtypevariable.swift
./validation-test/compiler_crashers_fixed/26284-swift-inflightdiagnostic-fixitreplacechars.swift
./validation-test/compiler_crashers_fixed/01034-swift-constraints-constraintsystem-getfixedtyperecursive.swift
./validation-test/compiler_crashers_fixed/01742-swift-arrayslicetype-get.swift
./validation-test/compiler_crashers_fixed/26423-llvm-bumpptrallocatorimpl-llvm-mallocallocator.swift
./validation-test/compiler_crashers_fixed/28143-llvm-foldingset-swift-structtype-computenodehash.swift
./validation-test/compiler_crashers_fixed/26055-swift-parser-skipsingle.swift
./validation-test/compiler_crashers_fixed/28686-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/26175-swift-genericparamlist-addnestedarchetypes.swift
./validation-test/compiler_crashers_fixed/00928-swift-tupletype-get.swift
./validation-test/compiler_crashers_fixed/25700-llvm-optional-swift-diagnostic-operator.swift
./validation-test/compiler_crashers_fixed/27649-swift-constraints-constraintsystem-finalize.swift
./validation-test/compiler_crashers_fixed/27831-swift-bracestmt-create.swift
./validation-test/compiler_crashers_fixed/25677-swift-genericsignature-profile.swift
./validation-test/compiler_crashers_fixed/27668-swift-boundgenerictype-get.swift
./validation-test/compiler_crashers_fixed/26531-swift-modulefile-maybereadgenericparams.swift
./validation-test/compiler_crashers_fixed/25952-swift-tuplepattern-createsimple.swift
./validation-test/compiler_crashers_fixed/01268-swift-lexer-lexidentifier.swift
./validation-test/compiler_crashers_fixed/01992-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/01783-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/25622-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/28068-swift-declcontext-getlocalconformances.swift
./validation-test/compiler_crashers_fixed/28478-swift-typebase-getdesugaredtype.swift
./validation-test/compiler_crashers_fixed/01050-swift-generictypeparamdecl-generictypeparamdecl.swift
./validation-test/compiler_crashers_fixed/01498-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/01167-swift-constraints-constraintsystem-opengeneric.swift
./validation-test/compiler_crashers_fixed/26425-std-function-func-swift-constraints-constraintsystem-simplifytype.swift
./validation-test/compiler_crashers_fixed/01132-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/25903-swift-diagnosticengine-flushactivediagnostic.swift
./validation-test/compiler_crashers_fixed/27165-swift-typechecker-checkunsupportedprotocoltype.swift
./validation-test/compiler_crashers_fixed/27024-swift-constraints-solution-simplifytype.swift
./validation-test/compiler_crashers_fixed/22253-swift-type-transform.swift
./validation-test/compiler_crashers_fixed/27701-swift-getllvmintrinsicid.swift
./validation-test/compiler_crashers_fixed/27011-swift-typechecker-validatetype.swift
./validation-test/compiler_crashers_fixed/01202-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/27243-swift-typebase-gettypevariables.swift
./validation-test/compiler_crashers_fixed/28489-this-genericenv-already-have-generic-context.swift
./validation-test/compiler_crashers_fixed/00120-swift-derivedconformance-deriveequatable.swift
./validation-test/compiler_crashers_fixed/26991-swift-abstractclosureexpr-setparams.swift
./validation-test/compiler_crashers_fixed/26417-swift-modulefile-gettype.swift
./validation-test/compiler_crashers_fixed/00640-swift-diagnosticengine-flushactivediagnostic.swift
./validation-test/compiler_crashers_fixed/28549-swift-typebase-getdesugaredtype.swift
./validation-test/compiler_crashers_fixed/00800-swift-typebase-isequal.swift
./validation-test/compiler_crashers_fixed/00027-void-map-over-sequence.swift
./validation-test/compiler_crashers_fixed/02207-swift-nominaltypedecl-getprotocols.swift
./validation-test/compiler_crashers_fixed/26151-swift-genericfunctiontype-get.swift
./validation-test/compiler_crashers_fixed/25386-swift-protocoltype-canonicalizeprotocols.swift
./validation-test/compiler_crashers_fixed/25885-swift-valuedecl-settype.swift
./validation-test/compiler_crashers_fixed/28335-swift-type-print.swift
./validation-test/compiler_crashers_fixed/28868-known-typebindings-end.swift
./validation-test/compiler_crashers_fixed/25940-swift-parser-parseexprsequence.swift
./validation-test/compiler_crashers_fixed/02221-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/27147-swift-boundgenerictype-get.swift
./validation-test/compiler_crashers_fixed/00973-std-function-func-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/27010-swift-patternbindingdecl-setpattern.swift
./validation-test/compiler_crashers_fixed/26852-swift-modulefile-lookupvalue.swift
./validation-test/compiler_crashers_fixed/02072-swift-functiontype-get.swift
./validation-test/compiler_crashers_fixed/25942-swift-lexer-kindofidentifier.swift
./validation-test/compiler_crashers_fixed/01361-swift-clangmoduleunit-getadaptermodule.swift
./validation-test/compiler_crashers_fixed/00460-bool.swift
./validation-test/compiler_crashers_fixed/27073-swift-constraints-constraint-create.swift
./validation-test/compiler_crashers_fixed/25410-swift-typechecker-resolvetypeincontext.swift
./validation-test/compiler_crashers_fixed/25529-void.swift
./validation-test/compiler_crashers_fixed/02010-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/00338-llvm-smallptrsetimplbase-smallptrsetimplbase.swift
./validation-test/compiler_crashers_fixed/00963-swift-diagnosticengine-flushactivediagnostic.swift
./validation-test/compiler_crashers_fixed/27710-swift-lexer-getlocforendoftoken.swift
./validation-test/compiler_crashers_fixed/25454-swift-abstractclosureexpr-setparams.swift
./validation-test/compiler_crashers_fixed/25560-swift-typechecker-overapproximateosversionsatlocation.swift
./validation-test/compiler_crashers_fixed/01709-vtable.swift
./validation-test/compiler_crashers_fixed/26796-swift-constraints-constraintsystem-simplifytype.swift
./validation-test/compiler_crashers_fixed/01154-swift-declcontext-lookupqualified.swift
./validation-test/compiler_crashers_fixed/26965-swift-functiontype-get.swift
./validation-test/compiler_crashers_fixed/26987-swift-constraints-constraintsystem-addconstraint.swift
./validation-test/compiler_crashers_fixed/02060-swift-constraints-constraintsystem-getfixedtyperecursive.swift
./validation-test/compiler_crashers_fixed/01135-swift-constraints-constraintsystem-addconstraint.swift
./validation-test/compiler_crashers_fixed/26131-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/02036-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/00832-swift-lexer-getlocforendoftoken.swift
./validation-test/compiler_crashers_fixed/01393-swift-genericfunctiontype-get.swift
./validation-test/compiler_crashers_fixed/01923-swift-lexer-lexstringliteral.swift
./validation-test/compiler_crashers_fixed/26023-swift-createimplicitconstructor.swift
./validation-test/compiler_crashers_fixed/27106-llvm-foldingset-swift-structtype-nodeequals.swift
./validation-test/compiler_crashers_fixed/26351-swift-modulefile-maybereadpattern.swift
./validation-test/compiler_crashers_fixed/27785-swift-typechecker-getinterfacetypefrominternaltype.swift
./validation-test/compiler_crashers_fixed/26359-swift-parser-parsedecl.swift
./validation-test/compiler_crashers_fixed/25605-llvm-smallvectorimpl-swift-diagnosticargument-operator.swift
./validation-test/compiler_crashers_fixed/27524-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/27534-swift-genericparamlist-addnestedarchetypes.swift
./validation-test/compiler_crashers_fixed/00992-swift-typebase-gettypevariables.swift
./validation-test/compiler_crashers_fixed/27118-swift-archetypebuilder-potentialarchetype-gettype.swift
./validation-test/compiler_crashers_fixed/02130-vtable.swift
./validation-test/compiler_crashers_fixed/26665-swift-conformancelookuptable-lookupconformance.swift
./validation-test/compiler_crashers_fixed/27998-swift-parser-consumetoken.swift
./validation-test/compiler_crashers_fixed/00265-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/01911-swift-archetypetype-setnestedtypes.swift
./validation-test/compiler_crashers_fixed/25839-swift-iterabledeclcontext-getmembers.swift
./validation-test/compiler_crashers_fixed/01743-swift-typechecker-checksubstitutions.swift
./validation-test/compiler_crashers_fixed/01210-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/01133-swift-clangimporter-loadextensions.swift
./validation-test/compiler_crashers_fixed/28863-t-is-archetypetype-t-isexistentialtype-expected-a-class-archetype-or-existential.swift
./validation-test/compiler_crashers_fixed/01468-swift-modulefile-getimportedmodules.swift
./validation-test/compiler_crashers_fixed/27495-swift-typechecker-addimplicitconstructors.swift
./validation-test/compiler_crashers_fixed/28579-unreachable-executed-at-swift-lib-sema-csdiag-cpp-5054.swift
./validation-test/compiler_crashers_fixed/26040-swift-parser-parsetoken.swift
./validation-test/compiler_crashers_fixed/00580-vtable.swift
./validation-test/compiler_crashers_fixed/25595-swift-parser-parsegetset.swift
./validation-test/compiler_crashers_fixed/00744-swift-constraints-constraintsystem-applysolution.swift
./validation-test/compiler_crashers_fixed/26566-swift-parser-parsedecl.swift
./validation-test/compiler_crashers_fixed/00280-llvm-foldingset-swift-classtype-nodeequals.swift
./validation-test/compiler_crashers_fixed/01258-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/28217-swift-diagnosticengine-emitdiagnostic.swift
./validation-test/compiler_crashers_fixed/01193-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/01912-llvm-foldingsetnodeid-operator.swift
./validation-test/compiler_crashers_fixed/26835-llvm-foldingset-swift-classtype-nodeequals.swift
./validation-test/compiler_crashers_fixed/01152-swift-derivedconformance-deriveequatable.swift
./validation-test/compiler_crashers_fixed/25621-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/25496-swift-typechecker-lookupmembertype.swift
./validation-test/compiler_crashers_fixed/00524-std-function-func-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/27478-llvm-errs.swift
./validation-test/compiler_crashers_fixed/25864-std-function-func-mapsignaturetype.swift
./validation-test/compiler_crashers_fixed/00975-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/00758-swift-typechecker-typecheckpattern.swift
./validation-test/compiler_crashers_fixed/25695-swift-typechecker-typecheckexpression.swift
./validation-test/compiler_crashers_fixed/27969-void.swift
./validation-test/compiler_crashers_fixed/00665-swift-streamprinter-printtext.swift
./validation-test/compiler_crashers_fixed/00998-bool.swift
./validation-test/compiler_crashers_fixed/00596-swift-modulefile-lookupvalue.swift
./validation-test/compiler_crashers_fixed/28276-swift-typechecker-computedefaultaccessibility.swift
./validation-test/compiler_crashers_fixed/00272-llvm-irbuilder-createcall.swift
./validation-test/compiler_crashers_fixed/01134-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/25848-swift-generictypeparamtype-get.swift
./validation-test/compiler_crashers_fixed/02146-swift-type-transform.swift
./validation-test/compiler_crashers_fixed/25795-swift-diagnosticengine-flushactivediagnostic.swift
./validation-test/compiler_crashers_fixed/01169-llvm-ondiskchainedhashtable-swift-modulefile-decltableinfo-find.swift
./validation-test/compiler_crashers_fixed/28632-unreachable-executed-at-swift-lib-ast-type-cpp-1130.swift
./validation-test/compiler_crashers_fixed/28600-isinsilmode-sil-should-only-be-a-keyword-in-sil-mode.swift
./validation-test/compiler_crashers_fixed/26465-swift-typebase-gettypevariables.swift
./validation-test/compiler_crashers_fixed/01530-swift-declcontext-lookupqualified.swift
./validation-test/compiler_crashers_fixed/25665-swift-inflightdiagnostic-fixitreplacechars.swift
./validation-test/compiler_crashers_fixed/26746-swift-parser-skipsingle.swift
./validation-test/compiler_crashers_fixed/26386-swift-typevisitor.swift
./validation-test/compiler_crashers_fixed/00397-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/25988-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/27108-swift-conformancelookuptable-updatelookuptable.swift
./validation-test/compiler_crashers_fixed/27372-void.swift
./validation-test/compiler_crashers_fixed/26311-swift-parser-parseanyidentifier.swift
./validation-test/compiler_crashers_fixed/00087-swift-archetypebuilder-resolvearchetype.swift
./validation-test/compiler_crashers_fixed/27123-swift-valuedecl-getoverloadsignature.swift
./validation-test/compiler_crashers_fixed/27751-swift-functiontype-get.swift
./validation-test/compiler_crashers_fixed/02217-swift-bracestmt-create.swift
./validation-test/compiler_crashers_fixed/26206-swift-constraints-constraintsystem-opengeneric.swift
./validation-test/compiler_crashers_fixed/27502-swift-typebase-getdesugaredtype.swift
./validation-test/compiler_crashers_fixed/01071-swift-modulefile-lookupvalue.swift
./validation-test/compiler_crashers_fixed/01793-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/26819-swift-typechecker-overapproximateosversionsatlocation.swift
./validation-test/compiler_crashers_fixed/01569-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/02111-swift-declcontext-lookupqualified.swift
./validation-test/compiler_crashers_fixed/28414-swift-typechecker-resolvewitness.swift
./validation-test/compiler_crashers_fixed/28066-swift-parentype-get.swift
./validation-test/compiler_crashers_fixed/00264-isvalididentifiercontinuationcodepoint.swift
./validation-test/compiler_crashers_fixed/25745-swift-substitutedtype-get.swift
./validation-test/compiler_crashers_fixed/00077-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/25951-swift-modulefile-maybereadforeignerrorconvention.swift
./validation-test/compiler_crashers_fixed/25799-swift-typechecker-checkconformance.swift
./validation-test/compiler_crashers_fixed/01349-swift-typebase-operator.swift
./validation-test/compiler_crashers_fixed/27770-swift-typechecker-resolvetypeincontext.swift
./validation-test/compiler_crashers_fixed/25825-swift-typechecker-checkinheritanceclause.swift
./validation-test/compiler_crashers_fixed/26251-swift-modulefile-gettype.swift
./validation-test/compiler_crashers_fixed/01458-swift-modulefile-maybereadpattern.swift
./validation-test/compiler_crashers_fixed/26021-swift-lexer-lexoperatoridentifier.swift
./validation-test/compiler_crashers_fixed/26526-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/27732-swift-valuedecl-getinterfacetype.swift
./validation-test/compiler_crashers_fixed/27964-swift-conformancelookuptable-compareprotocolconformances.swift
./validation-test/compiler_crashers_fixed/26125-swift-modulefile-lookupvalue.swift
./validation-test/compiler_crashers_fixed/25967-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/00633-swift-constraints-solution-computesubstitutions.swift
./validation-test/compiler_crashers_fixed/00039-string-join.script.swift
./validation-test/compiler_crashers_fixed/28543-unreachable-executed-at-swift-include-swift-ast-typevisitor-h-39.swift
./validation-test/compiler_crashers_fixed/25585-swift-sourcemanager-extracttext.swift
./validation-test/compiler_crashers_fixed/26855-swift-nominaltypedecl-prepareextensions.swift
./validation-test/compiler_crashers_fixed/27320-swift-boundgenerictype-get.swift
./validation-test/compiler_crashers_fixed/26895-swift-lexer-lexidentifier.swift
./validation-test/compiler_crashers_fixed/26516-swift-boundgenerictype-get.swift
./validation-test/compiler_crashers_fixed/25681-std-function-func-swift-constraints-constraintgraph-verify.swift
./validation-test/compiler_crashers_fixed/01769-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/00949-d.swift
./validation-test/compiler_crashers_fixed/26714-swift-parser-parsedeclextension.swift
./validation-test/compiler_crashers_fixed/26622-swift-sourcemanager-extracttext.swift
./validation-test/compiler_crashers_fixed/25416-swift-parser-parsedecl.swift
./validation-test/compiler_crashers_fixed/26353-swift-typechecker-getinterfacetypefrominternaltype.swift
./validation-test/compiler_crashers_fixed/25355-swift-typechecker-typecheckpatternbinding.swift
./validation-test/compiler_crashers_fixed/02247-swift-constraints-constraintsystem-finalize.swift
./validation-test/compiler_crashers_fixed/00471-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/24645-swift-diagnosticengine-flushactivediagnostic.swift
./validation-test/compiler_crashers_fixed/00266-swift-parser-parseexprorstmt.swift
./validation-test/compiler_crashers_fixed/28344-swift-type-transform.swift
./validation-test/compiler_crashers_fixed/01671-swift-structtype-get.swift
./validation-test/compiler_crashers_fixed/01266-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/28556-val-isa-used-on-a-null-pointer.swift
./validation-test/compiler_crashers_fixed/27175-llvm-foldingset-swift-tupletype-nodeequals.swift
./validation-test/compiler_crashers_fixed/00024-emitdirecttypemetadataref.swift
./validation-test/compiler_crashers_fixed/28185-llvm-foldingset-swift-genericfunctiontype-nodeequals.swift
./validation-test/compiler_crashers_fixed/28113-swift-constraints-constraintgraph-gatherconstraints.swift
./validation-test/compiler_crashers_fixed/00505-swift-lexer-lexidentifier.swift
./validation-test/compiler_crashers_fixed/26219-swift-astcontext-allocate.swift
./validation-test/compiler_crashers_fixed/28513-swift-modulefile-getdecl-llvm-pointerembeddedint-unsigned-int-31-llvm-optional-s.swift
./validation-test/compiler_crashers_fixed/27622-swift-typebase-isemptyexistentialcomposition.swift
./validation-test/compiler_crashers_fixed/26124-swift-genericparamlist-deriveallarchetypes.swift
./validation-test/compiler_crashers_fixed/28738-impl-genericparams-empty-key-depth-impl-genericparams-back-getdepth-key-index-im.swift
./validation-test/compiler_crashers_fixed/01035-swift-completegenerictyperesolver-resolvedependentmembertype.swift
./validation-test/compiler_crashers_fixed/01007-swift-modulefile-maybereadpattern.swift
./validation-test/compiler_crashers_fixed/28343-swift-genericfunctiontype-get.swift
./validation-test/compiler_crashers_fixed/28751-membertype-missing-type-witness.swift
./validation-test/compiler_crashers_fixed/27947-swift-parser-parsebraceitems.swift
./validation-test/compiler_crashers_fixed/01379-swift-parser-parsedeclinit.swift
./validation-test/compiler_crashers_fixed/25873-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/28056-swift-valuedecl-settype.swift
./validation-test/compiler_crashers_fixed/25563-swift-constraints-constraintsystem-solve.swift
./validation-test/compiler_crashers_fixed/25354-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/01269-swift-constraints-constraintsystem-getfixedtyperecursive.swift
./validation-test/compiler_crashers_fixed/28126-swift-getbuiltinvaluedecl.swift
./validation-test/compiler_crashers_fixed/01696-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/01602-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/01538-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/28485-swift-dependentmembertype-getname-const.swift
./validation-test/compiler_crashers_fixed/01089-llvm-foldingset-swift-tupletype-nodeequals.swift
./validation-test/compiler_crashers_fixed/00251-swift-constraints-constraintsystem-addconstraint.swift
./validation-test/compiler_crashers_fixed/27099-swift-decl-walk.swift
./validation-test/compiler_crashers_fixed/27920-void.swift
./validation-test/compiler_crashers_fixed/00363-swift-scopeinfo-addtoscope.swift
./validation-test/compiler_crashers_fixed/25362-swift-genericparamlist-create.swift
./validation-test/compiler_crashers_fixed/26765-swift-conformancelookuptable-getimplicitprotocols.swift
./validation-test/compiler_crashers_fixed/01091-getcallerdefaultarg.swift
./validation-test/compiler_crashers_fixed/26436-swift-lexer-kindofidentifier.swift
./validation-test/compiler_crashers_fixed/02074-swift-constraints-constraintlocatorbuilder-trysimplifytoexpr.swift
./validation-test/compiler_crashers_fixed/00607-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/25798-firsttarget.swift
./validation-test/compiler_crashers_fixed/26704-swift-substitutedtype-get.swift
./validation-test/compiler_crashers_fixed/26188-swift-typechecker-checkgenericarguments.swift
./validation-test/compiler_crashers_fixed/28647-unreachable-executed-at-swift-include-swift-ast-typevisitor-h-39.swift
./validation-test/compiler_crashers_fixed/27614-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/01509-bool.swift
./validation-test/compiler_crashers_fixed/00301-swift-declcontext-lookupqualified.swift
./validation-test/compiler_crashers_fixed/00381-swift-lexer-lexidentifier.swift
./validation-test/compiler_crashers_fixed/27870-swift-constraints-constraintsystem-optimizeconstraints.swift
./validation-test/compiler_crashers_fixed/28340-swift-type-getstring.swift
./validation-test/compiler_crashers_fixed/00925-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/28269-swift-expr-walk.swift
./validation-test/compiler_crashers_fixed/01851-swift-genericparamlist-addnestedarchetypes.swift
./validation-test/compiler_crashers_fixed/26396-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/01329-llvm-bitstreamcursor-readrecord.swift
./validation-test/compiler_crashers_fixed/00442-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/00711-swift-declcontext-lookupqualified.swift
./validation-test/compiler_crashers_fixed/28756-isobjc-cannot-get-root-type-of-objc-keypath.swift
./validation-test/compiler_crashers_fixed/01382-swift-constraints-constraintsystem-getfixedtyperecursive.swift
./validation-test/compiler_crashers_fixed/27567-swift-constraints-constraintsystem-addoverloadset.swift
./validation-test/compiler_crashers_fixed/24947-swift-lexer-leximpl.swift
./validation-test/compiler_crashers_fixed/26954-swift-functiontype-get.swift
./validation-test/compiler_crashers_fixed/00062-ioctl.swift
./validation-test/compiler_crashers_fixed/01868-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/25893-swift-declcontext-lookupqualified.swift
./validation-test/compiler_crashers_fixed/01779-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/28529-arrow-isfolded-already-folded-expr-in-sequence.swift
./validation-test/compiler_crashers_fixed/00584-swift-constraints-constraintlocator-profile.swift
./validation-test/compiler_crashers_fixed/27853-swift-constraints-constraintsystem-addconstraint.swift
./validation-test/compiler_crashers_fixed/01021-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/25499-swift-typechecker-addimplicitconstructors.swift
./validation-test/compiler_crashers_fixed/25922-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/03326-swift-archetypetype-setnestedtypes.swift
./validation-test/compiler_crashers_fixed/27892-swift-extensiondecl-getmembers.swift
./validation-test/compiler_crashers_fixed/25899-swift-tupleexpr-tupleexpr.swift
./validation-test/compiler_crashers_fixed/26572-swift-typechecker-checkinheritanceclause.swift
./validation-test/compiler_crashers_fixed/27617-swift-markasobjc.swift
./validation-test/compiler_crashers_fixed/00398-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/26914-void.swift
./validation-test/compiler_crashers_fixed/01078-void.swift
./validation-test/compiler_crashers_fixed/28741-anonymous-namespace-verifier-walktodeclpost-swift-decl.swift
./validation-test/compiler_crashers_fixed/00313-swift-typechecker-getprotocol.swift
./validation-test/compiler_crashers_fixed/26398-swift-parser-parseexprclosure.swift
./validation-test/compiler_crashers_fixed/25552-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/00646-llvm-raw-fd-ostream-write-impl.swift
./validation-test/compiler_crashers_fixed/00509-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/01597-swift-structtype-get.swift
./validation-test/compiler_crashers_fixed/00676-std-function-func-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/28762-valuetype-hasunboundgenerictype-valuetype-hastypeparameter.swift
./validation-test/compiler_crashers_fixed/28152-swift-conformancelookuptable-lookupconformance.swift
./validation-test/compiler_crashers_fixed/25746-swift-normalprotocolconformance-setwitness.swift
./validation-test/compiler_crashers_fixed/00974-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/28678-result-case-not-implemented.swift
./validation-test/compiler_crashers_fixed/28476-anonymous-namespace-verifier-walktodeclpost-swift-decl.swift
./validation-test/compiler_crashers_fixed/26338-swift-constraints-constraintsystem-simplifytype.swift
./validation-test/compiler_crashers_fixed/00185-swift-completegenerictyperesolver-resolvegenerictypeparamtype.swift
./validation-test/compiler_crashers_fixed/27585-swift-astcontext-loadextensions.swift
./validation-test/compiler_crashers_fixed/25610-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/26969-swift-modulefile-lookupvalue.swift
./validation-test/compiler_crashers_fixed/26172-swift-modulefile-lookupvalue.swift
./validation-test/compiler_crashers_fixed/00369-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/28091-swift-diagnosticengine-flushactivediagnostic.swift
./validation-test/compiler_crashers_fixed/26870-swift-mangle-mangler-mangleidentifier.swift
./validation-test/compiler_crashers_fixed/01139-swift-genericparamlist-addnestedarchetypes.swift
./validation-test/compiler_crashers_fixed/28824-hasval.swift
./validation-test/compiler_crashers_fixed/28630-anonymous-namespace-verifier-walktostmtpost-swift-stmt.swift
./validation-test/compiler_crashers_fixed/01922-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/01659-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/01192-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/28140-swift-typedecl-getdeclaredinterfacetype.swift
./validation-test/compiler_crashers_fixed/26314-swift-typechecker-overapproximateosversionsatlocation.swift
./validation-test/compiler_crashers_fixed/00565-swift-lexer-getlocforendoftoken.swift
./validation-test/compiler_crashers_fixed/00535-swift-type-transform.swift
./validation-test/compiler_crashers_fixed/01767-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/25809-swift-sourcemanager-extracttext.swift
./validation-test/compiler_crashers_fixed/27610-swift-conformancelookuptable-lookupconformances.swift
./validation-test/compiler_crashers_fixed/01961-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/26126-std-function-func-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/00930-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/26793-swift-abstractclosureexpr-setparams.swift
./validation-test/compiler_crashers_fixed/28685-unreachable-executed-at-swift-lib-ast-type-cpp-1344.swift
./validation-test/compiler_crashers_fixed/01137-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/01916-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/01278-swift-modulefile-maybereadconformance.swift
./validation-test/compiler_crashers_fixed/26094-swift-typebase-getsuperclass.swift
./validation-test/compiler_crashers_fixed/02215-swift-modulefile-gettype.swift
./validation-test/compiler_crashers_fixed/28131-void.swift
./validation-test/compiler_crashers_fixed/26267-swift-astprinter-printtextimpl.swift
./validation-test/compiler_crashers_fixed/00556-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/26948-swift-nominaltypedecl-getmembers.swift
./validation-test/compiler_crashers_fixed/27230-swift-declcontext-lookupqualified.swift
./validation-test/compiler_crashers_fixed/02173-swift-parser-skipsingle.swift
./validation-test/compiler_crashers_fixed/26231-swift-constraints-constraintgraph-change-undo.swift
./validation-test/compiler_crashers_fixed/27689-swift-constraints-constraintsystem-addtypevariableconstraintstoworklist.swift
./validation-test/compiler_crashers_fixed/00007-convenience-init-in-extension.swift
./validation-test/compiler_crashers_fixed/01732-swift-parser-parsebraceitemlist.swift
./validation-test/compiler_crashers_fixed/26630-swift-constraints-constraintgraphscope-constraintgraphscope.swift
./validation-test/compiler_crashers_fixed/01893-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/27833-swift-conformancelookuptable-lookupconformances.swift
./validation-test/compiler_crashers_fixed/27232-swift-funcdecl-isunaryoperator.swift
./validation-test/compiler_crashers_fixed/02062-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/26873-void.swift
./validation-test/compiler_crashers_fixed/24900-swift-typebase-getmembersubstitutions.swift
./validation-test/compiler_crashers_fixed/26794-firsttarget.swift
./validation-test/compiler_crashers_fixed/28149-addcurriedselftype.swift
./validation-test/compiler_crashers_fixed/00627-bool.swift
./validation-test/compiler_crashers_fixed/01384-swift-declcontext-lookupqualified.swift
./validation-test/compiler_crashers_fixed/00368-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/27428-swift-diagnosticengine-emitdiagnostic.swift
./validation-test/compiler_crashers_fixed/01739-swift-constraints-constraintsystem-solvesimplified.swift
./validation-test/compiler_crashers_fixed/01560-vtable.swift
./validation-test/compiler_crashers_fixed/28168-bool.swift
./validation-test/compiler_crashers_fixed/01691-clang-astcontext-getrecordtype.swift
./validation-test/compiler_crashers_fixed/28057-swift-modulefile-declcommenttableinfo-readdata.swift
./validation-test/compiler_crashers_fixed/00623-validateattributes.swift
./validation-test/compiler_crashers_fixed/25740-swift-valuedecl-setinterfacetype.swift
./validation-test/compiler_crashers_fixed/25378-swift-constraints-constraintsystem-matchdeepequalitytypes.swift
./validation-test/compiler_crashers_fixed/22391-swift-genericparamlist-deriveallarchetypes.swift
./validation-test/compiler_crashers_fixed/01433-swift-constraints-solution-simplifytype.swift
./validation-test/compiler_crashers_fixed/26841-std-function-func-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/01054-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/26597-swift-typebase-isequal.swift
./validation-test/compiler_crashers_fixed/01287-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/01435-swift-genericparamlist-addnestedarchetypes.swift
./validation-test/compiler_crashers_fixed/26029-std-function-func-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/00845-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/01081-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/01800-swift-functiontype-get.swift
./validation-test/compiler_crashers_fixed/01860-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/00870-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/26915-std-function-func-swift-constraints-constraintsystem-simplifytype.swift
./validation-test/compiler_crashers_fixed/02028-swift-constraints-constraintsystem-simplify.swift
./validation-test/compiler_crashers_fixed/25586-std-function-func-mapsignaturetype.swift
./validation-test/compiler_crashers_fixed/27498-swift-typechecker-typecheckpatternbinding.swift
./validation-test/compiler_crashers_fixed/27184-swift-lexer-getlocforendoftoken.swift
./validation-test/compiler_crashers_fixed/00867-swift-archetypetype-setnestedtypes.swift
./validation-test/compiler_crashers_fixed/27004-swift-constraints-constraintsystem-matchtypes.swift
./validation-test/compiler_crashers_fixed/27040-swift-clangimporter-loadextensions.swift
./validation-test/compiler_crashers_fixed/25349-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/28270-swift-constraints-constraintsystem-diagnosefailureforexpr.swift
./validation-test/compiler_crashers_fixed/27745-swift-modulefile-getdecl.swift
./validation-test/compiler_crashers_fixed/01866-swift-archetypetype-setnestedtypes.swift
./validation-test/compiler_crashers_fixed/25419-swift-archetypebuilder-finalize.swift
./validation-test/compiler_crashers_fixed/28564-swift-nominaltypedecl-getdeclaredtype-const.swift
./validation-test/compiler_crashers_fixed/27902-llvm-foldingset-swift-boundgenerictype-nodeequals.swift
./validation-test/compiler_crashers_fixed/01966-swift-clangmoduleunit-getimportedmodules.swift
./validation-test/compiler_crashers_fixed/26680-swift-modulefile-getdeclcontext.swift
./validation-test/compiler_crashers_fixed/00258-swift-constraints-constraintsystem-resolveoverload.swift
./validation-test/compiler_crashers_fixed/00931-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/28203-swift-typebase-getdesugaredtype.swift
./validation-test/compiler_crashers_fixed/28862-swift-protocoldecl-getinheritedprotocols-const.swift
./validation-test/compiler_crashers_fixed/01501-swift-diagnosticengine-flushactivediagnostic.swift
./validation-test/compiler_crashers_fixed/26032-swift-typechecker-availablerange.swift
./validation-test/compiler_crashers_fixed/01289-void.swift
./validation-test/compiler_crashers_fixed/25714-llvm-densemap-swift-identifier.swift
./validation-test/compiler_crashers_fixed/26498-swift-sourcefile-lookupcache-lookupvalue.swift
./validation-test/compiler_crashers_fixed/27153-swift-conformancelookuptable-updatelookuptable.swift
./validation-test/compiler_crashers_fixed/01473-swift-typebase-gettypevariables.swift
./validation-test/compiler_crashers_fixed/28007-swift-scopeinfo-addtoscope.swift
./validation-test/compiler_crashers_fixed/28283-swift-archetypebuilder-finalize.swift
./validation-test/compiler_crashers_fixed/25764-swift-archetypebuilder-inferrequirementswalker-walktotypepost.swift
./validation-test/compiler_crashers_fixed/01818-swift-typebase-isspecialized.swift
./validation-test/compiler_crashers_fixed/26324-llvm-raw-ostream-write.swift
./validation-test/compiler_crashers_fixed/00484-llvm-errs.swift
./validation-test/compiler_crashers_fixed/27131-isvalidoverload.swift
./validation-test/compiler_crashers_fixed/28495-ed-getdeclcontext-ismodulescopecontext-non-top-level-extensions-make-private-fil.swift
./validation-test/compiler_crashers_fixed/28655-base-base-hastypeparameter.swift
./validation-test/compiler_crashers_fixed/01449-swift-modulefile-getdecl.swift
./validation-test/compiler_crashers_fixed/02224-swift-typebase-operator.swift
./validation-test/compiler_crashers_fixed/26220-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/00692-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/28128-swift-parser-parseidentifier.swift
./validation-test/compiler_crashers_fixed/28629-type-hastypeparameter-already-have-an-interface-type.swift
./validation-test/compiler_crashers_fixed/25696-llvm-bitstreamcursor-read.swift
./validation-test/compiler_crashers_fixed/27393-swift-archetypebuilder-potentialarchetype-gettype.swift
./validation-test/compiler_crashers_fixed/25705-swift-typechecker-availablerange.swift
./validation-test/compiler_crashers_fixed/25761-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/00625-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/01930-void.swift
./validation-test/compiler_crashers_fixed/28704-swift-newmangling-astmangler-appendcontext-swift-declcontext-const.swift
./validation-test/compiler_crashers_fixed/27924-swift-typechecker-typecheckexpression.swift
./validation-test/compiler_crashers_fixed/26463-swift-typechecker-getinterfacetypefrominternaltype.swift
./validation-test/compiler_crashers_fixed/27569-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/00637-swift-lexer-getlocforendoftoken.swift
./validation-test/compiler_crashers_fixed/26113-swift-archetypebuilder-addgenericsignature.swift
./validation-test/compiler_crashers_fixed/27001-swift-constraints-solution-solution.swift
./validation-test/compiler_crashers_fixed/28062-swift-classdecl-checkobjcancestry.swift
./validation-test/compiler_crashers_fixed/26667-swift-iterabledeclcontext-getmembers.swift
./validation-test/compiler_crashers_fixed/26736-swift-tupletype-get.swift
./validation-test/compiler_crashers_fixed/26587-swift-typechecker-computeaccessibility.swift
./validation-test/compiler_crashers_fixed/27414-llvm-errs.swift
./validation-test/compiler_crashers_fixed/26070-swift-serialization-serializer-writedecl.swift
./validation-test/compiler_crashers_fixed/01577-getcallerdefaultarg.swift
./validation-test/compiler_crashers_fixed/26998-std-function-func-setboundvarstypeerror.swift
./validation-test/compiler_crashers_fixed/28017-swift-protocoldecl-existentialtypesupportedslow.swift
./validation-test/compiler_crashers_fixed/00996-swift-constraints-solution-computesubstitutions.swift
./validation-test/compiler_crashers_fixed/01052-swift-genericsignature-get.swift
./validation-test/compiler_crashers_fixed/25580-swift-typechecker-addimplicitconstructors.swift
./validation-test/compiler_crashers_fixed/28438-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/01345-swift-typechecker-getdefaulttype.swift
./validation-test/compiler_crashers_fixed/25436-swift-derivedfileunit-lookupvalue.swift
./validation-test/compiler_crashers_fixed/26053-llvm-bitstreamcursor-read.swift
./validation-test/compiler_crashers_fixed/01563-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/00851-std-function-func-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/26750-swift-modulefile-lookupvalue.swift
./validation-test/compiler_crashers_fixed/25814-swift-typeloc-iserror.swift
./validation-test/compiler_crashers_fixed/27352-swift-astprinter-printtextimpl.swift
./validation-test/compiler_crashers_fixed/27237-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/27597-swift-modulefile-maybereadpattern.swift
./validation-test/compiler_crashers_fixed/00685-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/01371-swift-constraints-constraintsystem-simplifytype.swift
./validation-test/compiler_crashers_fixed/26388-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/01664-swift-parser-parsetypetuplebody.swift
./validation-test/compiler_crashers_fixed/27401-void.swift
./validation-test/compiler_crashers_fixed/28646-swift-lvaluetype-get-swift-type.swift
./validation-test/compiler_crashers_fixed/26924-mapsignaturefunctiontype.swift
./validation-test/compiler_crashers_fixed/01047-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/28232-swift-typechecker-typecheckfunctionbodyuntil.swift
./validation-test/compiler_crashers_fixed/24960-swift-typedecl-getdeclaredinterfacetype.swift
./validation-test/compiler_crashers_fixed/27046-swift-declcontext-getlocalconformances.swift
./validation-test/compiler_crashers_fixed/25329-swift-typebase-getmembersubstitutions.swift
./validation-test/compiler_crashers_fixed/00879-swift-classtype-get.swift
./validation-test/compiler_crashers_fixed/27993-swift-parser-parsedeclfunc.swift
./validation-test/compiler_crashers_fixed/27793-swift-typechecker-checkdeclattributes.swift
./validation-test/compiler_crashers_fixed/00236-swift-typechecker-typecheckforeachbinding.swift
./validation-test/compiler_crashers_fixed/26729-swift-parser-skipsingle.swift
./validation-test/compiler_crashers_fixed/26233-swift-iterabledeclcontext-getmembers.swift
./validation-test/compiler_crashers_fixed/00768-llvm-bitstreamcursor-readrecord.swift
./validation-test/compiler_crashers_fixed/27659-swift-parser-parsedeclclass.swift
./validation-test/compiler_crashers_fixed/26327-swift-modulefile-gettype.swift
./validation-test/compiler_crashers_fixed/26693-swift-parser-skipsingle.swift
./validation-test/compiler_crashers_fixed/01333-swift-abstractstoragedecl-makecomputed.swift
./validation-test/compiler_crashers_fixed/00012-emitdirecttypemetadataref.swift
./validation-test/compiler_crashers_fixed/27306-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/25815-swift-removeshadoweddecls.swift
./validation-test/compiler_crashers_fixed/27527-swift-nominaltypedecl-getmembers.swift
./validation-test/compiler_crashers_fixed/26360-swift-typechecker-validategenericfuncsignature.swift
./validation-test/compiler_crashers_fixed/01114-swift-declcontext-lookupqualified.swift
./validation-test/compiler_crashers_fixed/00884-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/28651-swift-cleanupillformedexpressionraii-doit-swift-expr-swift-astcontext-cleanupill.swift
./validation-test/compiler_crashers_fixed/25784-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/26950-swift-constraints-constraintsystem-solve.swift
./validation-test/compiler_crashers_fixed/28011-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/28351-swift-functiontype-get.swift
./validation-test/compiler_crashers_fixed/28133-swift-parser-parsedeclenum.swift
./validation-test/compiler_crashers_fixed/25577-swift-markasobjc.swift
./validation-test/compiler_crashers_fixed/26988-swift-modulefile-getimportedmodules.swift
./validation-test/compiler_crashers_fixed/25985-swift-constructordecl-setbodyparams.swift
./validation-test/compiler_crashers_fixed/28358-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/26083-std-function-func-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/00499-llvm-foldingsetimpl-findnodeorinsertpos.swift
./validation-test/compiler_crashers_fixed/27712-swift-constraints-constraintsystem-solvesimplified.swift
./validation-test/compiler_crashers_fixed/00725-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/00234-llvm-foldingset-swift-genericfunctiontype-nodeequals.swift
./validation-test/compiler_crashers_fixed/27564-swift-constraints-constraintsystem-matchfunctiontypes.swift
./validation-test/compiler_crashers_fixed/26958-swift-typebase-isequal.swift
./validation-test/compiler_crashers_fixed/28329-swift-archetypebuilder-potentialarchetype-gettype.swift
./validation-test/compiler_crashers_fixed/01938-swift-parser-skipsingle.swift
./validation-test/compiler_crashers_fixed/02197-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/26868-std-function-func-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/28298-swift-namealiastype-getsinglydesugaredtype.swift
./validation-test/compiler_crashers_fixed/01837-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/01770-swift-typechecker-buildarrayinjectionfnref.swift
./validation-test/compiler_crashers_fixed/02226-swift-modulefile-getdecl.swift
./validation-test/compiler_crashers_fixed/01398-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/26586-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/02249-swift-constraints-constraintsystem-opengeneric.swift
./validation-test/compiler_crashers_fixed/27588-swift-constraints-constraintsystem-simplifyconstraint.swift
./validation-test/compiler_crashers_fixed/26000-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/28641-result-case-not-implemented.swift
./validation-test/compiler_crashers_fixed/27716-swift-lexer-getlocforendoftoken.swift
./validation-test/compiler_crashers_fixed/28105-swift-constraints-constraintsystem-simplifymemberconstraint.swift
./validation-test/compiler_crashers_fixed/04592-swift-constraints-constraintsystem-simplifyconstraint.swift
./validation-test/compiler_crashers_fixed/01610-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/26492-swift-astcontext-getidentifier.swift
./validation-test/compiler_crashers_fixed/00809-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/26933-swift-typechecker-coercepatterntotype.swift
./validation-test/compiler_crashers_fixed/01439-swift-boundgenerictype-get.swift
./validation-test/compiler_crashers_fixed/28681-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/00473-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/26989-swift-typechecker-definedefaultconstructor.swift
./validation-test/compiler_crashers_fixed/00348-llvm-densemapbase-llvm-smalldensemap-std-pair-swift-cantype.swift
./validation-test/compiler_crashers_fixed/00740-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/00588-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/00605-swift-clangmoduleunit-getadaptermodule.swift
./validation-test/compiler_crashers_fixed/01506-swift-typechecker-validategenericfuncsignature.swift
./validation-test/compiler_crashers_fixed/28200-swift-typebase-getdesugaredtype.swift
./validation-test/compiler_crashers_fixed/28368-swift-expr-propagatelvalueaccesskind.swift
./validation-test/compiler_crashers_fixed/26371-swift-typechecker-validatetype.swift
./validation-test/compiler_crashers_fixed/27951-swift-astcontext-getspecializedconformance.swift
./validation-test/compiler_crashers_fixed/01562-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/01521-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/26884-std-function-func-swift-constraints-constraintsystem-simplifytype.swift
./validation-test/compiler_crashers_fixed/02087-swift-generictypeparamdecl-generictypeparamdecl.swift
./validation-test/compiler_crashers_fixed/00675-swift-astcontext-getprotocol.swift
./validation-test/compiler_crashers_fixed/26866-swift-nominaltypedecl-getmembers.swift
./validation-test/compiler_crashers_fixed/25752-swift-astcontext-allocate.swift
./validation-test/compiler_crashers_fixed/00714-void.swift
./validation-test/compiler_crashers_fixed/26511-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/01545-swift-streamprinter-printtext.swift
./validation-test/compiler_crashers_fixed/28848-iscanonicaltypeincontext-result-builder.swift
./validation-test/compiler_crashers_fixed/26193-swift-archetypebuilder-potentialarchetype-gettype.swift
./validation-test/compiler_crashers_fixed/00307-addminimumprotocols.swift
./validation-test/compiler_crashers_fixed/26612-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/00312-swift-genericparamlist-create.swift
./validation-test/compiler_crashers_fixed/27733-swift-constraints-constraintsystem-constraintsystem.swift
./validation-test/compiler_crashers_fixed/28761-allowoverwrite-e-haslvalueaccesskind-l-value-access-kind-has-already-been-set.swift
./validation-test/compiler_crashers_fixed/25501-swift-genericparamlist-addnestedarchetypes.swift
./validation-test/compiler_crashers_fixed/26086-swift-typebase-getsuperclass.swift
./validation-test/compiler_crashers_fixed/28164-swift-typebase-getdesugaredtype.swift
./validation-test/compiler_crashers_fixed/00052-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/00527-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/01972-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/27173-swift-namelookup-findlocalval-visitbracestmt.swift
./validation-test/compiler_crashers_fixed/01285-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/04450-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/25853-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/27480-void.swift
./validation-test/compiler_crashers_fixed/27854-swift-clangimporter-loadextensions.swift
./validation-test/compiler_crashers_fixed/27774-filtervalues.swift
./validation-test/compiler_crashers_fixed/25477-swift-genericparamlist-deriveallarchetypes.swift
./validation-test/compiler_crashers_fixed/27721-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/26049-swift-modulefile-lookupvalue.swift
./validation-test/compiler_crashers_fixed/00237-swift-declrefexpr-setspecialized.swift
./validation-test/compiler_crashers_fixed/00187-swift-lowering-typeconverter-getfunctiontypewithcaptures.swift
./validation-test/compiler_crashers_fixed/02200-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/01688-swift-constraints-constraintsystem-matchtypes.swift
./validation-test/compiler_crashers_fixed/02149-swift-constraints-constraintgraph-gatherconstraints.swift
./validation-test/compiler_crashers_fixed/01738-vtable.swift
./validation-test/compiler_crashers_fixed/01037-swift-nominaltypedecl-computetype.swift
./validation-test/compiler_crashers_fixed/01388-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/28253-swift-constraints-constraintsystem-matchdeepequalitytypes.swift
./validation-test/compiler_crashers_fixed/25890-swift-typechecker-checkdeclattributesearly.swift
./validation-test/compiler_crashers_fixed/02105-swift-modulefile-getdecl.swift
./validation-test/compiler_crashers_fixed/28861-gpdecl-getdepth-generictypeparamdecl-invaliddepth-parameter-hasnt-been-validated.swift
./validation-test/compiler_crashers_fixed/25460-swift-expr-walk.swift
./validation-test/compiler_crashers_fixed/01964-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/26848-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/01670-swift-modulefile-maybereadgenericparams.swift
./validation-test/compiler_crashers_fixed/26143-swift-declattribute-canattributeappearondeclkind.swift
./validation-test/compiler_crashers_fixed/28348-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/02138-swift-modulefile-maybereadpattern.swift
./validation-test/compiler_crashers_fixed/26323-swift-genericparamlist-deriveallarchetypes.swift
./validation-test/compiler_crashers_fixed/25669-swift-sourcefile-lookupcache-lookupvalue.swift
./validation-test/compiler_crashers_fixed/27179-swift-modulefile-gettype.swift
./validation-test/compiler_crashers_fixed/25543-swift-typechecker-typecheckexpression.swift
./validation-test/compiler_crashers_fixed/26186-swift-modulefile-gettype.swift
./validation-test/compiler_crashers_fixed/00901-ab.swift
./validation-test/compiler_crashers_fixed/28540-swift-namelookup-findlocalval-visitguardstmt-swift-guardstmt.swift
./validation-test/compiler_crashers_fixed/21765-vtable.swift
./validation-test/compiler_crashers_fixed/00634-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/25372-swift-lexer-leximpl.swift
./validation-test/compiler_crashers_fixed/26194-swift-constraints-constraintsystem-simplifytype.swift
./validation-test/compiler_crashers_fixed/02041-swift-typechecker-checksubstitutions.swift
./validation-test/compiler_crashers_fixed/01778-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/27996-llvm-ondiskchainedhashtable-swift-modulefile-decltableinfo-find.swift
./validation-test/compiler_crashers_fixed/01327-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/27681-swift-constraints-constraintsystem-assignfixedtype.swift
./validation-test/compiler_crashers_fixed/27300-swift-unboundgenerictype-get.swift
./validation-test/compiler_crashers_fixed/01359-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/25631-swift-parser-parseexprpostfix.swift
./validation-test/compiler_crashers_fixed/01100-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/26671-swift-typechecker-checkinheritanceclause.swift
./validation-test/compiler_crashers_fixed/05431-swift-declname-printpretty.swift
./validation-test/compiler_crashers_fixed/26978-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/27767-swift-constructordecl-constructordecl.swift
./validation-test/compiler_crashers_fixed/28182-anonymous-namespace-favorcalloverloads.swift
./validation-test/compiler_crashers_fixed/26678-swift-typechecker-overapproximateosversionsatlocation.swift
./validation-test/compiler_crashers_fixed/01810-swift-clangimporter-implementation-finishloadingclangmodule.swift
./validation-test/compiler_crashers_fixed/28622-vd-getdeclcontext-ismodulescopecontext.swift
./validation-test/compiler_crashers_fixed/27102-void.swift
./validation-test/compiler_crashers_fixed/00679-swift-clangmoduleunit-getimportedmodules.swift
./validation-test/compiler_crashers_fixed/00788-t.swift
./validation-test/compiler_crashers_fixed/27653-swift-archetypebuilder-getallarchetypes.swift
./validation-test/compiler_crashers_fixed/01347-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/01389-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/00886-swift-tuplepattern-create.swift
./validation-test/compiler_crashers_fixed/26093-swift-declname-printpretty.swift
./validation-test/compiler_crashers_fixed/25504-swift-constraints-constraintgraphnode-getadjacency.swift
./validation-test/compiler_crashers_fixed/27330-swift-conformancelookuptable-lookupconformance.swift
./validation-test/compiler_crashers_fixed/00526-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/25481-swift-modulefile-getimportedmodules.swift
./validation-test/compiler_crashers_fixed/01683-swift-nominaltype-get.swift
./validation-test/compiler_crashers_fixed/00495-llvm-foldingsetnodeid-operator.swift
./validation-test/compiler_crashers_fixed/28409-swift-archetypebuilder-maptypeintocontext.swift
./validation-test/compiler_crashers_fixed/28597-first-char-of-sub-string-may-not-be-a-digit.swift
./validation-test/compiler_crashers_fixed/01838-void.swift
./validation-test/compiler_crashers_fixed/27658-swift-constraints-constraintgraph-removeconstraint.swift
./validation-test/compiler_crashers_fixed/27684-swift-constraints-constraintsystem-getalternativeliteraltypes.swift
./validation-test/compiler_crashers_fixed/28771-unreachable-executed-at-swift-include-swift-ast-cantypevisitor-h-41.swift
./validation-test/compiler_crashers_fixed/25998-swift-conformancelookuptable-updatelookuptable.swift
./validation-test/compiler_crashers_fixed/26800-swift-constraints-constraintsystem-addtypevariableconstraintstoworklist.swift
./validation-test/compiler_crashers_fixed/25611-std-function-func-swift-typebase-gettypevariables.swift
./validation-test/compiler_crashers_fixed/25534-swift-archetypebuilder-potentialarchetype-gettype.swift
./validation-test/compiler_crashers_fixed/00383-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/25446-swift-typeloc-iserror.swift
./validation-test/compiler_crashers_fixed/28593-unreachable-executed-at-swift-lib-ast-type-cpp-3771.swift
./validation-test/compiler_crashers_fixed/27913-swift-typechecker-checkgenericarguments.swift
./validation-test/compiler_crashers_fixed/27766-swift-constraints-solution-solution.swift
./validation-test/compiler_crashers_fixed/27897-swift-typeloc-iserror.swift
./validation-test/compiler_crashers_fixed/01952-swift-functiontype-get.swift
./validation-test/compiler_crashers_fixed/27432-swift-typechecker-validatetype.swift
./validation-test/compiler_crashers_fixed/25720-swift-constraints-constraintsystem-simplifyconstraint.swift
./validation-test/compiler_crashers_fixed/02218-swift-typebase-getdesugaredtype.swift
./validation-test/compiler_crashers_fixed/26782-swift-genericfunctiontype-partialsubstgenericargs.swift
./validation-test/compiler_crashers_fixed/28497-unreachable-executed-at-swift-lib-ast-type-cpp-294.swift
./validation-test/compiler_crashers_fixed/01823-llvm-sys-path-append.swift
./validation-test/compiler_crashers_fixed/01747-swift-constraints-constraintsystem-getfixedtyperecursive.swift
./validation-test/compiler_crashers_fixed/00893-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/27566-swift-constraints-constraintgraphscope-constraintgraphscope.swift
./validation-test/compiler_crashers_fixed/25881-swift-sourcefile-lookupcache-lookupvalue.swift
./validation-test/compiler_crashers_fixed/01124-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/26556-swift-inflightdiagnostic-fixitreplacechars.swift
./validation-test/compiler_crashers_fixed/27257-swift-lexer-kindofidentifier.swift
./validation-test/compiler_crashers_fixed/28693-swift-genericenvironment-queryinterfacetypesubstitutions-operator-swift-substitu.swift
./validation-test/compiler_crashers_fixed/00951-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/12748-swift-constraints-constraintsystem-simplify.swift
./validation-test/compiler_crashers_fixed/02005-swift-parser-parsedeclvargetset.swift
./validation-test/compiler_crashers_fixed/28691-result-case-not-implemented.swift
./validation-test/compiler_crashers_fixed/28754-value-openexistentials-end-didnt-see-this-ove-in-a-containing-openexistentialexp.swift
./validation-test/compiler_crashers_fixed/00662-swift-typebase-isequal.swift
./validation-test/compiler_crashers_fixed/21847-llvm-foldingset-swift-tupletype-nodeequals.swift
./validation-test/compiler_crashers_fixed/01799-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/00990-swift-typechecker-checksubstitutions.swift
./validation-test/compiler_crashers_fixed/28428-swift-typebase-gatherallsubstitutions.swift
./validation-test/compiler_crashers_fixed/01293-swift-modulefile-getimportedmodules.swift
./validation-test/compiler_crashers_fixed/27663-swift-nominaltypedecl-prepareextensions.swift
./validation-test/compiler_crashers_fixed/01194-swift-declcontext-lookupqualified.swift
./validation-test/compiler_crashers_fixed/01058-swift-declcontext-lookupqualified.swift
./validation-test/compiler_crashers_fixed/27053-swift-typechecker-checkdeclarationavailability.swift
./validation-test/compiler_crashers_fixed/01525-swift-astvisitor.swift
./validation-test/compiler_crashers_fixed/27695-swift-constraints-constraintsystem-performmemberlookup.swift
./validation-test/compiler_crashers_fixed/26281-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/00948-swift-modulefile-readmembers.swift
./validation-test/compiler_crashers_fixed/01991-swift-declcontext-lookupqualified.swift
./validation-test/compiler_crashers_fixed/01240-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/01504-llvm-foldingset-swift-tupletype-nodeequals.swift
./validation-test/compiler_crashers_fixed/25715-swift-parser-parseexprclosure.swift
./validation-test/compiler_crashers_fixed/00435-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/28120-swift-unqualifiedlookup-unqualifiedlookup.swift
./validation-test/compiler_crashers_fixed/26601-swift-genericsignature-genericsignature.swift
./validation-test/compiler_crashers_fixed/28330-swift-genericparamlist-getsubstitutionmap.swift
./validation-test/compiler_crashers_fixed/25844-void.swift
./validation-test/compiler_crashers_fixed/28323-swift-typebase-getstring.swift
./validation-test/compiler_crashers_fixed/00074-swift-typeloc-iserror.swift
./validation-test/compiler_crashers_fixed/07285-swift-astprinter-printname.swift
./validation-test/compiler_crashers_fixed/27922-swift-unqualifiedlookup-unqualifiedlookup.swift
./validation-test/compiler_crashers_fixed/27499-llvm-bitstreamcursor-read.swift
./validation-test/compiler_crashers_fixed/01328-swift-modulefile-lookupvalue.swift
./validation-test/compiler_crashers_fixed/26063-swift-tuplepattern-createsimple.swift
./validation-test/compiler_crashers_fixed/25812-swift-astcontext-allocate.swift
./validation-test/compiler_crashers_fixed/00653-swift-typebase-getanyoptionalobjecttype.swift
./validation-test/compiler_crashers_fixed/28199-swift-constraints-constraintsystem-performmemberlookup.swift
./validation-test/compiler_crashers_fixed/28640-swift-tupletype-get-llvm-arrayref-swift-tupletypeelt-swift-astcontext-const.swift
./validation-test/compiler_crashers_fixed/24394-swift-typevariabletype-implementation-getrepresentative.swift
./validation-test/compiler_crashers_fixed/02090-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/01949-llvm-ondiskchainedhashtable-swift-modulefile-decltableinfo-find.swift
./validation-test/compiler_crashers_fixed/00190-swift-constraints-constraintgraph-unbindtypevariable.swift
./validation-test/compiler_crashers_fixed/25606-swift-constraints-solution-solution.swift
./validation-test/compiler_crashers_fixed/26649-swift-lexer-leximpl.swift
./validation-test/compiler_crashers_fixed/27327-swift-genericparamlist-deriveallarchetypes.swift
./validation-test/compiler_crashers_fixed/00072-llvm-bitstreamcursor-readrecord.swift
./validation-test/compiler_crashers_fixed/25866-swift-silbuilder-createdeallocbox.swift
./validation-test/compiler_crashers_fixed/02230-std-function-func-mapsignaturetype.swift
./validation-test/compiler_crashers_fixed/26317-swift-memberlookuptable-addmember.swift
./validation-test/compiler_crashers_fixed/25414-swift-generictypeparamtype-get.swift
./validation-test/compiler_crashers_fixed/27662-swift-valuedecl-settype.swift
./validation-test/compiler_crashers_fixed/26399-swift-genericparamlist-addnestedarchetypes.swift
./validation-test/compiler_crashers_fixed/25525-swift-modulefile-getimportedmodules.swift
./validation-test/compiler_crashers_fixed/01583-llvm-prettystacktraceentry-prettystacktraceentry.swift
./validation-test/compiler_crashers_fixed/28093-swift-archetypetype-getnew.swift
./validation-test/compiler_crashers_fixed/25820-swift-decl-getrawcomment.swift
./validation-test/compiler_crashers_fixed/28371-swift-genericparamlist-getsubstitutionmap.swift
./validation-test/compiler_crashers_fixed/26568-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/01518-swift-typebase-getdesugaredtype.swift
./validation-test/compiler_crashers_fixed/25489-swift-valuedecl-getinterfacetype.swift
./validation-test/compiler_crashers_fixed/01890-swift-clangmoduleunit-getadaptermodule.swift
./validation-test/compiler_crashers_fixed/26741-swift-abstractstoragedecl-makecomputed.swift
./validation-test/compiler_crashers_fixed/00170-swift-parser-skipsingle.swift
./validation-test/compiler_crashers_fixed/27133-swift-genericparamlist-getasgenericsignatureelements.swift
./validation-test/compiler_crashers_fixed/02091-swift-constraints-constraintsystem-finalize.swift
./validation-test/compiler_crashers_fixed/26719-swift-structtype-get.swift
./validation-test/compiler_crashers_fixed/02101-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/26599-swift-abstractclosureexpr-setparams.swift
./validation-test/compiler_crashers_fixed/01232-swift-completegenerictyperesolver-resolvegenerictypeparamtype.swift
./validation-test/compiler_crashers_fixed/00482-swift-constraints-constraintsystem-getfixedtyperecursive.swift
./validation-test/compiler_crashers_fixed/01363-swift-modulefile-maybereadpattern.swift
./validation-test/compiler_crashers_fixed/02065-swift-constraints-constraintsystem-getconstraintlocator.swift
./validation-test/compiler_crashers_fixed/25546-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/25818-swift-modulefile-getdecl.swift
./validation-test/compiler_crashers_fixed/01280-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/25479-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/08893-std-function-func-swift-archetypebuilder-maptypeintocontext.swift
./validation-test/compiler_crashers_fixed/01311-swift-completegenerictyperesolver-resolvedependentmembertype.swift
./validation-test/compiler_crashers_fixed/27163-swift-abstractclosureexpr-setparams.swift
./validation-test/compiler_crashers_fixed/27697-std-function-func-setboundvarstypeerror.swift
./validation-test/compiler_crashers_fixed/26840-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/02202-swift-boundgenerictype-get.swift
./validation-test/compiler_crashers_fixed/26857-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/26532-swift-substitutedtype-get.swift
./validation-test/compiler_crashers_fixed/00533-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/27979-swift-conformancelookuptable-lookupconformances.swift
./validation-test/compiler_crashers_fixed/28213-swift-expr-walk.swift
./validation-test/compiler_crashers_fixed/28002-swift-parser-parsebraceitems.swift
./validation-test/compiler_crashers_fixed/25896-swift-serialization-serializer-writedeclattribute.swift
./validation-test/compiler_crashers_fixed/28828-unreachable-executed-at-swift-lib-ast-type-cpp-3237.swift
./validation-test/compiler_crashers_fixed/28820-fl-isinout-caller-did-not-set-flags-correctly.swift
./validation-test/compiler_crashers_fixed/26381-swift-genericsignature-genericsignature.swift
./validation-test/compiler_crashers_fixed/26445-swift-scopeinfo-addtoscope.swift
./validation-test/compiler_crashers_fixed/25831-swift-parser-parsedecl.swift
./validation-test/compiler_crashers_fixed/25637-swift-typechecker-lookupmember.swift
./validation-test/compiler_crashers_fixed/02021-std-function-func-swift-archetypebuilder-maptypeintocontext.swift
./validation-test/compiler_crashers_fixed/25381-swift-nominaltypedecl-makemembervisible.swift
./validation-test/compiler_crashers_fixed/27333-swift-constraints-constraintsystem-solve.swift
./validation-test/compiler_crashers_fixed/00598-clang-sema-lookupname.swift
./validation-test/compiler_crashers_fixed/28370-swift-decomposeparamtype.swift
./validation-test/compiler_crashers_fixed/26616-swift-maybeaddaccessorstovariable.swift
./validation-test/compiler_crashers_fixed/28581-anonymous-namespace-findcapturedvars-checktype-swift-type-swift-sourceloc.swift
./validation-test/compiler_crashers_fixed/26926-swift-typechecker-checkinheritanceclause.swift
./validation-test/compiler_crashers_fixed/27826-swift-lexer-lexstringliteral.swift
./validation-test/compiler_crashers_fixed/25758-swift-sourcemanager-extracttext.swift
./validation-test/compiler_crashers_fixed/28154-swift-genericsignature-get.swift
./validation-test/compiler_crashers_fixed/26628-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/27057-addminimumprotocols.swift
./validation-test/compiler_crashers_fixed/28847-type-hasunboundgenerictype.swift
./validation-test/compiler_crashers_fixed/01483-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/00656-swift-astcontext-getidentifier.swift
./validation-test/compiler_crashers_fixed/28698-isactuallycanonicalornull-forming-a-cantype-out-of-a-non-canonical-type.swift
./validation-test/compiler_crashers_fixed/26156-swift-parser-consumeidentifier.swift
./validation-test/compiler_crashers_fixed/25649-firsttarget.swift
./validation-test/compiler_crashers_fixed/01450-swift-modulefile-maybereadgenericparams.swift
./validation-test/compiler_crashers_fixed/25476-swift-genericfunctiontype-get.swift
./validation-test/compiler_crashers_fixed/00647-std-function-func-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/27674-swift-extensiondecl-getmembers.swift
./validation-test/compiler_crashers_fixed/27903-swift-genericfunctiontype-get.swift
./validation-test/compiler_crashers_fixed/01526-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/28279-swift-archetypebuilder-potentialarchetype-getnestedtype.swift
./validation-test/compiler_crashers_fixed/26235-swift-modulefile-getimportedmodules.swift
./validation-test/compiler_crashers_fixed/01740-swift-constraints-constraintsystem-getfixedtyperecursive.swift
./validation-test/compiler_crashers_fixed/01295-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/00950-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/01175-swift-nominaltypedecl-computetype.swift
./validation-test/compiler_crashers_fixed/00759-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/00094-swift-bracestmt-create.swift
./validation-test/compiler_crashers_fixed/28071-swift-clangimporter-implementation-importdeclandcacheimpl.swift
./validation-test/compiler_crashers_fixed/27687-swift-classtype-get.swift
./validation-test/compiler_crashers_fixed/28487-parent-parent-is-nominaltype-parent-is-boundgenerictype-parent-is-unboundgeneric.swift
./validation-test/compiler_crashers_fixed/28410-swift-typechecker-typecheckdecl.swift
./validation-test/compiler_crashers_fixed/27948-swift-constraints-constraintsystem-performmemberlookup.swift
./validation-test/compiler_crashers_fixed/26822-swift-modulefile-getdecl.swift
./validation-test/compiler_crashers_fixed/27406-swift-protocoltype-canonicalizeprotocols.swift
./validation-test/compiler_crashers_fixed/01159-swift-declcontext-lookupqualified.swift
./validation-test/compiler_crashers_fixed/00732-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/00095-swift-clangimporter-implementation-mergepropinfointoaccessor.swift
./validation-test/compiler_crashers_fixed/01485-swift-constraints-constraintsystem-addconstraint.swift
./validation-test/compiler_crashers_fixed/27581-swift-modulefile-maybereadgenericparams.swift
./validation-test/compiler_crashers_fixed/27762-swift-typechecker-validategenericfuncsignature.swift
./validation-test/compiler_crashers_fixed/26487-swift-astcontext-allocate.swift
./validation-test/compiler_crashers_fixed/01215-swift-optional-swift-diagnostic-operator.swift
./validation-test/compiler_crashers_fixed/01322-swift-functiontype-get.swift
./validation-test/compiler_crashers_fixed/26889-swift-tupletype-get.swift
./validation-test/compiler_crashers_fixed/28347-swift-typechecker-checkinheritanceclause.swift
./validation-test/compiler_crashers_fixed/00221-swift-constraints-constraintgraph-removeconstraint.swift
./validation-test/compiler_crashers_fixed/27651-swift-genericparamlist-deriveallarchetypes.swift
./validation-test/compiler_crashers_fixed/28042-void.swift
./validation-test/compiler_crashers_fixed/25636-swift-typeloc-iserror.swift
./validation-test/compiler_crashers_fixed/25935-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/27576-swift-markasobjc.swift
./validation-test/compiler_crashers_fixed/00566-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/01436-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/26414-swift-genericsignature-genericsignature.swift
./validation-test/compiler_crashers_fixed/25588-swift-typedecl-getdeclaredinterfacetype.swift
./validation-test/compiler_crashers_fixed/00036-szone-malloc-should-clear.swift
./validation-test/compiler_crashers_fixed/01099-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/27101-swift-constraints-constraintgraph-gatherconstraints.swift
./validation-test/compiler_crashers_fixed/00882-a.swift
./validation-test/compiler_crashers_fixed/00188-swift-removeshadoweddecls.swift
./validation-test/compiler_crashers_fixed/26177-swift-typechecker-typecheckexpression.swift
./validation-test/compiler_crashers_fixed/00677-swift-typebase-isequal.swift
./validation-test/compiler_crashers_fixed/27386-swift-cantype-isobjcexistentialtypeimpl.swift
./validation-test/compiler_crashers_fixed/28050-swift-abstractfunctiondecl-setgenericparams.swift
./validation-test/compiler_crashers_fixed/26897-swift-constraints-constraintsystem-simplifytype.swift
./validation-test/compiler_crashers_fixed/01374-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/26576-llvm-foldingset-swift-structtype-nodeequals.swift
./validation-test/compiler_crashers_fixed/00954-swift-clangmoduleunit-getadaptermodule.swift
./validation-test/compiler_crashers_fixed/27862-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/25383-void.swift
./validation-test/compiler_crashers_fixed/26471-swift-iterabledeclcontext-getmembers.swift
./validation-test/compiler_crashers_fixed/01126-swift-parser-parseexprorstmt.swift
./validation-test/compiler_crashers_fixed/26990-swift-importdecl-findbestimportkind.swift
./validation-test/compiler_crashers_fixed/25353-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/01948-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/00982-b.swift
./validation-test/compiler_crashers_fixed/27531-swift-typechecker-coercepatterntotype.swift
./validation-test/compiler_crashers_fixed/28784-genericsigorenv-isnull-getgenericsignature-getcanonicalsignature-genericenv-getg.swift
./validation-test/compiler_crashers_fixed/01703-swift-constraints-constraintlocator-profile.swift
./validation-test/compiler_crashers_fixed/28682-swift-lowering-silgenfunction-emitopenexistential.swift
./validation-test/compiler_crashers_fixed/25494-swift-type-print.swift
./validation-test/compiler_crashers_fixed/28732-type-hasarchetype-not-fully-substituted.swift
./validation-test/compiler_crashers_fixed/01072-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/26050-swift-parser-parsedeclenumcase.swift
./validation-test/compiler_crashers_fixed/26506-swift-diagnosticengine-emitdiagnostic.swift
./validation-test/compiler_crashers_fixed/01693-swift-typealiasdecl-typealiasdecl.swift
./validation-test/compiler_crashers_fixed/28800-unreachable-executed-at-swift-lib-ast-type-cpp-3247.swift
./validation-test/compiler_crashers_fixed/27358-swift-constraints-constraintgraph-removeconstraint.swift
./validation-test/compiler_crashers_fixed/26721-swift-parser-skipsingle.swift
./validation-test/compiler_crashers_fixed/27937-swift-substitutedtype-get.swift
./validation-test/compiler_crashers_fixed/28744-swift-genericenvironment-maptypeoutofcontext-swift-genericenvironment-swift-type.swift
./validation-test/compiler_crashers_fixed/01532-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/27293-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/00122-swift-typechecker-coercepatterntotype.swift
./validation-test/compiler_crashers_fixed/28735-reftype-hastypeparameter-cannot-have-a-dependent-type-here.swift
./validation-test/compiler_crashers_fixed/28525-tok-isany-tok-identifier-tok-kw-self-tok-kw-self-tok-kw-throws.swift
./validation-test/compiler_crashers_fixed/27417-swift-constraints-constraintsystem-simplifyconformstoconstraint.swift
./validation-test/compiler_crashers_fixed/27091-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/28084-swift-modulefile-loadallmembers.swift
./validation-test/compiler_crashers_fixed/01537-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/25895-swift-diagnosticengine-emitdiagnostic.swift
./validation-test/compiler_crashers_fixed/26451-swift-parser-parsedecl.swift
./validation-test/compiler_crashers_fixed/28024-swift-constraints-constraintlocatorbuilder-trysimplifytoexpr.swift
./validation-test/compiler_crashers_fixed/27402-std-function-func-checkaccessibility.swift
./validation-test/compiler_crashers_fixed/27448-swift-nominaltypedecl-computeinterfacetype.swift
./validation-test/compiler_crashers_fixed/27396-swift-typebase-getimplicitlyunwrappedoptionalobjecttype.swift
./validation-test/compiler_crashers_fixed/26973-swift-boundgenerictype-get.swift
./validation-test/compiler_crashers_fixed/27556-swift-genericfunctiontype-get.swift
./validation-test/compiler_crashers_fixed/25804-swift-parser-parseexprsequence.swift
./validation-test/compiler_crashers_fixed/25619-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/25910-swift-valuedecl.swift
./validation-test/compiler_crashers_fixed/25753-swift-conformancelookuptable-updatelookuptable.swift
./validation-test/compiler_crashers_fixed/00794-swift-typebase-isspecialized.swift
./validation-test/compiler_crashers_fixed/01186-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/26538-swift-parser-parsegetsetimpl.swift
./validation-test/compiler_crashers_fixed/27846-llvm-smallvectorimpl-swift-protocolconformance-operator.swift
./validation-test/compiler_crashers_fixed/25442-llvm-smdiagnostic-smdiagnostic.swift
./validation-test/compiler_crashers_fixed/27746-void.swift
./validation-test/compiler_crashers_fixed/28532-unreachable-executed-at-swift-lib-ast-type-cpp-174.swift
./validation-test/compiler_crashers_fixed/00775-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/28811-gpdecl-getdepth-generictypeparamdecl-invaliddepth-parameter-hasnt-been-validated.swift
./validation-test/compiler_crashers_fixed/26255-std-function-func-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/00138-swift-modulefile-maybereadpattern.swift
./validation-test/compiler_crashers_fixed/26629-llvm-smallvectorimpl-swift-diagnosticargument-operator.swift
./validation-test/compiler_crashers_fixed/01481-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/26655-vtable.swift
./validation-test/compiler_crashers_fixed/26222-swift-genericfunctiontype-get.swift
./validation-test/compiler_crashers_fixed/00420-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/25579-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/28552-as-isfolded-already-folded-as-expr-in-sequence.swift
./validation-test/compiler_crashers_fixed/24969-swift-vardecl-emitlettovarnoteifsimple.swift
./validation-test/compiler_crashers_fixed/27693-swift-constraints-constraintsystem-opengeneric.swift
./validation-test/compiler_crashers_fixed/27787-swift-typechecker-overapproximateosversionsatlocation.swift
./validation-test/compiler_crashers_fixed/25485-swift-patternbindingdecl-setpattern.swift
./validation-test/compiler_crashers_fixed/25697-swift-parser-parsegetsetimpl.swift
./validation-test/compiler_crashers_fixed/26740-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/01915-swift-typechecker-getprotocol.swift
./validation-test/compiler_crashers_fixed/00935-swift-constraints-constraintsystem-solve.swift
./validation-test/compiler_crashers_fixed/27039-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/27470-swift-constraints-constraintsystem-solverec.swift
./validation-test/compiler_crashers_fixed/25512-swift-genericsignature-get.swift
./validation-test/compiler_crashers_fixed/28005-swift-constraints-constraintgraphnode-getadjacency.swift
./validation-test/compiler_crashers_fixed/25009-swift-typechecker-resolvetypeincontext.swift
./validation-test/compiler_crashers_fixed/28032-swift-typechecker-computecaptures.swift
./validation-test/compiler_crashers_fixed/28235-swift-archetypebuilder-addsametyperequirementtoconcrete.swift
./validation-test/compiler_crashers_fixed/01321-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/02124-swift-type-transform.swift
./validation-test/compiler_crashers_fixed/01480-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/25884-swift-parser-parsedeclvargetset.swift
./validation-test/compiler_crashers_fixed/25948-swift-archetypebuilder-potentialarchetype-gettype.swift
./validation-test/compiler_crashers_fixed/24670-isunknownobjecttype.swift
./validation-test/compiler_crashers_fixed/26708-swift-parser-parseversiontuple.swift
./validation-test/compiler_crashers_fixed/00606-swift-typechecker-conformstoprotocol.swift
./validation-test/compiler_crashers_fixed/00908-l.swift
./validation-test/compiler_crashers_fixed/01540-swift-constraints-solution-solution.swift
./validation-test/compiler_crashers_fixed/25688-swift-lexer-lexidentifier.swift
./validation-test/compiler_crashers_fixed/00984-swift-constraints-constraintsystem-simplifyconstraint.swift
./validation-test/compiler_crashers_fixed/01988-swift-modulefile-lookupvalue.swift
./validation-test/compiler_crashers_fixed/02019-swift-protocoltype-canonicalizeprotocols.swift
./validation-test/compiler_crashers_fixed/26288-std-function-func-mapsignaturetype.swift
./validation-test/compiler_crashers_fixed/26005-swift-typechecker-resolvepattern.swift
./validation-test/compiler_crashers_fixed/28391-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/26640-swift-functiontype-get.swift
./validation-test/compiler_crashers_fixed/26380-swift-boundgenerictype-get.swift
./validation-test/compiler_crashers_fixed/27557-swift-parser-parseidentifier.swift
./validation-test/compiler_crashers_fixed/27626-llvm-smdiagnostic-smdiagnostic.swift
./validation-test/compiler_crashers_fixed/01314-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/27135-swift-patternbindingdecl-setpattern.swift
./validation-test/compiler_crashers_fixed/28834-t-isnull-t-is-inouttype.swift
./validation-test/compiler_crashers_fixed/02327-swift-clangimporter-lookupvalue.swift
./validation-test/compiler_crashers_fixed/25972-swift-parser-skipsingle.swift
./validation-test/compiler_crashers_fixed/01148-std-function-func-swift-constraints-constraintsystem-simplifytype.swift
./validation-test/compiler_crashers_fixed/01839-swift-modulefile-gettype.swift
./validation-test/compiler_crashers_fixed/27328-swift-moduledecl-lookupvalue.swift
./validation-test/compiler_crashers_fixed/27612-swift-typechecker-checkunsupportedprotocoltype.swift
./validation-test/compiler_crashers_fixed/26358-swift-typechecker-checkinheritanceclause.swift
./validation-test/compiler_crashers_fixed/26555-swift-typechecker-checkgenericarguments.swift
./validation-test/compiler_crashers_fixed/25918-swift-parser-parseidentifier.swift
./validation-test/compiler_crashers_fixed/28867-swift-iterativetypechecker-issatisfied-swift-typecheckrequest.swift
./validation-test/compiler_crashers_fixed/00289-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/28356-swift-typechecker-resolvetypewitness.swift
./validation-test/compiler_crashers_fixed/01070-void.swift
./validation-test/compiler_crashers_fixed/26911-swift-modulefile-getimportedmodules.swift
./validation-test/compiler_crashers_fixed/26749-swift-constraints-constraintsystem-solve.swift
./validation-test/compiler_crashers_fixed/26786-llvm-smallvectorimpl-swift-diagnosticargument-operator.swift
./validation-test/compiler_crashers_fixed/28578-result-case-not-implemented.swift
./validation-test/compiler_crashers_fixed/00487-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/01190-swift-completegenerictyperesolver-resolvegenerictypeparamtype.swift
./validation-test/compiler_crashers_fixed/00757-x.swift
./validation-test/compiler_crashers_fixed/25616-swift-parser-diagnose.swift
./validation-test/compiler_crashers_fixed/26367-swift-lexer-kindofidentifier.swift
./validation-test/compiler_crashers_fixed/00806-swift-modulefile-lookupvalue.swift
./validation-test/compiler_crashers_fixed/01942-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/02069-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/00100-swift-constraints-constraintsystem-addtypevariableconstraintstoworklist.swift
./validation-test/compiler_crashers_fixed/26470-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/01283-swift-modulefile-getdecl.swift
./validation-test/compiler_crashers_fixed/25478-swift-astcontext-allocate.swift
./validation-test/compiler_crashers_fixed/27962-swift-rebindselfinconstructorexpr-getcalledconstructor.swift
./validation-test/compiler_crashers_fixed/26723-swift-modulefile-getdecl.swift
./validation-test/compiler_crashers_fixed/28561-input-hastypevariable-output-hastypevariable.swift
./validation-test/compiler_crashers_fixed/26785-swift-typechecker-addimplicitconstructors.swift
./validation-test/compiler_crashers_fixed/00643-swift-completegenerictyperesolver-resolvedependentmembertype.swift
./validation-test/compiler_crashers_fixed/25556-swift-modulefile-getcommentfordecl.swift
./validation-test/compiler_crashers_fixed/01761-swift-genericfunctiontype-get.swift
./validation-test/compiler_crashers_fixed/00303-swift-constraints-constraintsystem-getfixedtyperecursive.swift
./validation-test/compiler_crashers_fixed/28804-second.swift
./validation-test/compiler_crashers_fixed/28764-swift-protocolconformanceref-llvm-function-ref-swift-protocolconformanceref-swif.swift
./validation-test/compiler_crashers_fixed/26482-swift-genericparamlist-addnestedarchetypes.swift
./validation-test/compiler_crashers_fixed/26764-swift-parser-parsedeclenumcase.swift
./validation-test/compiler_crashers_fixed/27923-swift-modulefile-gettype.swift
./validation-test/compiler_crashers_fixed/28676-currentconstraintsolverarena-no-constraint-solver-active.swift
./validation-test/compiler_crashers_fixed/27523-swift-lexer-leximpl.swift
./validation-test/compiler_crashers_fixed/28772-loc-isvalid-diagnosing-attribute-with-invalid-location.swift
./validation-test/compiler_crashers_fixed/27149-swift-typeloc-iserror.swift
./validation-test/compiler_crashers_fixed/26935-swift-patternbindingdecl-setpattern.swift
./validation-test/compiler_crashers_fixed/25698-swift-parser-parsedeclinit.swift
./validation-test/compiler_crashers_fixed/26716-swift-patternbindingdecl-create.swift
./validation-test/compiler_crashers_fixed/27647-swift-tuplepattern-createsimple.swift
./validation-test/compiler_crashers_fixed/28789-swift-genericsignaturebuilder-addrequirement-swift-requirementrepr-const-swift-g.swift
./validation-test/compiler_crashers_fixed/28736-anonymous-namespacesilverifier-require.swift
./validation-test/compiler_crashers_fixed/28573-type-hasarchetype-archetype-in-interface-type.swift
./validation-test/compiler_crashers_fixed/26122-swift-lexer-lexidentifier.swift
./validation-test/compiler_crashers_fixed/00330-swift-structtype-get.swift
./validation-test/compiler_crashers_fixed/02209-swift-typebase-operator.swift
./validation-test/compiler_crashers_fixed/28866-unreachable-executed-at-swift-include-swift-ast-cantypevisitor-h-41.swift
./validation-test/compiler_crashers_fixed/01275-swift-diagnosticengine-diagnose.swift
./validation-test/compiler_crashers_fixed/01331-swift-modulefile-getimportedmodules.swift
./validation-test/compiler_crashers_fixed/25919-llvm-foldingsetimpl-findnodeorinsertpos.swift
./validation-test/compiler_crashers_fixed/27191-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/28858-val-isa-used-on-a-null-pointer.swift
./validation-test/compiler_crashers_fixed/27071-swift-nominaltypedecl-computeinterfacetype.swift
./validation-test/compiler_crashers_fixed/28626-objectty-is-lvaluetype-objectty-is-inouttype-cannot-have-inout-or-lvalue-wrapped.swift
./validation-test/compiler_crashers_fixed/28299-swift-lookupvisibledecls.swift
./validation-test/compiler_crashers_fixed/28684-isactuallycanonicalornull-forming-a-cantype-out-of-a-non-canonical-type.swift
./validation-test/compiler_crashers_fixed/27221-swift-typechecker-lookupunqualified.swift
./validation-test/compiler_crashers_fixed/27780-swift-conformancelookuptable-lookupconformances.swift
./validation-test/compiler_crashers_fixed/00150-swift-parser-parseparameterclause.swift
./validation-test/compiler_crashers_fixed/26189-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/00117-swift-declrefexpr-setgenericargs.swift
./validation-test/compiler_crashers_fixed/27291-swift-modulefile-getdeclcontext.swift
./validation-test/compiler_crashers_fixed/27078-swift-abstractclosureexpr-setparams.swift
./validation-test/compiler_crashers_fixed/00716-swift-archetypetype-setnestedtypes.swift
./validation-test/compiler_crashers_fixed/27077-swift-modulefile-gettype.swift
./validation-test/compiler_crashers_fixed/00816-swift-isplatformactive.swift
./validation-test/compiler_crashers_fixed/01228-swift-constraints-constraintsystem-opengeneric.swift
./validation-test/compiler_crashers_fixed/00713-swift-declcontext-lookupqualified.swift
./validation-test/compiler_crashers_fixed/27283-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/01505-swift-constraints-constraintsystem-simplifymemberconstraint.swift
./validation-test/compiler_crashers_fixed/01881-swift-structtype-get.swift
./validation-test/compiler_crashers_fixed/25808-swift-typechecker-validategenerictypesignature.swift
./validation-test/compiler_crashers_fixed/00829-swift-constraints-constraintsystem-addconstraint.swift
./validation-test/compiler_crashers_fixed/25964-swift-typechecker-resolvetypeincontext.swift
./validation-test/compiler_crashers_fixed/00263-swift-constraints-constraintsystem-opentype.swift
./validation-test/compiler_crashers_fixed/01362-swift-constraints-constraintgraph-unbindtypevariable.swift
./validation-test/compiler_crashers_fixed/26807-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/26276-swift-modulefile-maybereadforeignerrorconvention.swift
./validation-test/compiler_crashers_fixed/28258-swift-specializedprotocolconformance-gettypewitnesssubstanddecl.swift
./validation-test/compiler_crashers_fixed/26603-swift-lexer-kindofidentifier.swift
./validation-test/compiler_crashers_fixed/28121-swift-typechecker-coercepatterntotype.swift
./validation-test/compiler_crashers_fixed/01896-swift-parser-parsedecl.swift
./validation-test/compiler_crashers_fixed/26660-swift-constraints-constraintsystem-solve.swift
./validation-test/compiler_crashers_fixed/24232-swift-lexer-leximpl.swift
./validation-test/compiler_crashers_fixed/26018-swift-parser-skipsingle.swift
./validation-test/compiler_crashers_fixed/02079-swift-module-lookupvalue.swift
./validation-test/compiler_crashers_fixed/02107-swift-functiontype-get.swift
./validation-test/compiler_crashers_fixed/28551-anonymous-namespace-verifier-walktostmtpost-swift-stmt.swift
./validation-test/compiler_crashers_fixed/01164-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/27630-swift-scopeinfo-addtoscope.swift
./validation-test/compiler_crashers_fixed/00191-swift-astprinter-printtextimpl.swift
./validation-test/compiler_crashers_fixed/00353-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/27116-swift-constraints-constraintgraph-unbindtypevariable.swift
./validation-test/compiler_crashers_fixed/27194-swift-pattern-foreachvariable.swift
./validation-test/compiler_crashers_fixed/01509-bool-edited.swift
./validation-test/compiler_crashers_fixed/00897-swift-modulefile-lookupvalue.swift
./validation-test/compiler_crashers_fixed/01455-swift-constraints-solution-computesubstitutions.swift
./validation-test/compiler_crashers_fixed/27347-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/26548-swift-lexer-lexoperatoridentifier.swift
./validation-test/compiler_crashers_fixed/25575-swift-streamprinter-printtext.swift
./validation-test/compiler_crashers_fixed/02056-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/28852-swift-genericsignaturebuilder-addrequirement-swift-requirementrepr-const-swift-g.swift
./validation-test/compiler_crashers_fixed/28608-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/28728-d-isbeingvalidated-d-hasvalidsignature.swift
./validation-test/compiler_crashers_fixed/00113-swift-constraints-constraintsystem-solve.swift
./validation-test/compiler_crashers_fixed/26619-swift-functiontype-get.swift
./validation-test/compiler_crashers_fixed/01395-swift-parser-skipsingle.swift
./validation-test/compiler_crashers_fixed/00342-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/26917-swift-nominaltype-get.swift
./validation-test/compiler_crashers_fixed/27609-std-function-func-checkaccessibility.swift
./validation-test/compiler_crashers_fixed/01578-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/01471-swift-clangmoduleunit-getimportedmodules.swift
./validation-test/compiler_crashers_fixed/25582-swift-typechecker-resolvesuperclass.swift
./validation-test/compiler_crashers_fixed/27848-swift-tupletype-get.swift
./validation-test/compiler_crashers_fixed/27236-swift-typechecker-typecheckbinding.swift
./validation-test/compiler_crashers_fixed/00550-std-function-func-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/27239-swift-typechecker-definedefaultconstructor.swift
./validation-test/compiler_crashers_fixed/01986-swift-parser-parseexprunary.swift
./validation-test/compiler_crashers_fixed/01341-broken-function-found-compilation-aborted.swift
./validation-test/compiler_crashers_fixed/26865-swift-conformancelookuptable-getimplicitprotocols.swift
./validation-test/compiler_crashers_fixed/25522-swift-typebase-getsuperclass.swift
./validation-test/compiler_crashers_fixed/27308-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/01115-swift-lexer-lexidentifier.swift
./validation-test/compiler_crashers_fixed/01516-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/27501-swift-namelookup-lookupinmodule.swift
./validation-test/compiler_crashers_fixed/00791-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/00563-cerror.swift
./validation-test/compiler_crashers_fixed/01495-swift-functiontype-get.swift
./validation-test/compiler_crashers_fixed/27735-llvm-foldingset-swift-tupletype-nodeequals.swift
./validation-test/compiler_crashers_fixed/27398-swift-declcontext-getlocalconformances.swift
./validation-test/compiler_crashers_fixed/25376-swift-parser-parsedecl.swift
./validation-test/compiler_crashers_fixed/00977-llvm-ondiskchainedhashtable-swift-modulefile-decltableinfo-find.swift
./validation-test/compiler_crashers_fixed/25393-swift-protocolconformance-subst.swift
./validation-test/compiler_crashers_fixed/25350-swift-typeloc-iserror.swift
./validation-test/compiler_crashers_fixed/25963-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/27747-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/01404-swift-tupletype-get.swift
./validation-test/compiler_crashers_fixed/00771-x.swift
./validation-test/compiler_crashers_fixed/26073-finalizegenericparamlist.swift
./validation-test/compiler_crashers_fixed/01252-swift-nominaltypedecl-computetype.swift
./validation-test/compiler_crashers_fixed/26236-swift-astcontext-getloadedmodule.swift
./validation-test/compiler_crashers_fixed/26771-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/27253-llvm-ondiskchainedhashtable-swift-modulefile-decltableinfo-find.swift
./validation-test/compiler_crashers_fixed/01042-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/01482-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/00417-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/26292-swift-modulefile-getimportedmodules.swift
./validation-test/compiler_crashers_fixed/28690-isactuallycanonicalornull-forming-a-cantype-out-of-a-non-canonical-type.swift
./validation-test/compiler_crashers_fixed/25780-swift-scopeinfo-addtoscope.swift
./validation-test/compiler_crashers_fixed/01559-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/28674-unreachable-executed-at-swift-lib-sema-csapply-cpp-5856.swift
./validation-test/compiler_crashers_fixed/01255-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/28020-llvm-smallvectorimpl-swift-decl-insert.swift
./validation-test/compiler_crashers_fixed/28352-swift-typechecker-configureinterfacetype.swift
./validation-test/compiler_crashers_fixed/01681-swift-nominaltypedecl-preparelookuptable.swift
./validation-test/compiler_crashers_fixed/26589-swift-astcontext-allocate.swift
./validation-test/compiler_crashers_fixed/01561-swift-constraints-solution-computesubstitutions.swift
./validation-test/compiler_crashers_fixed/27855-swift-nominaltype-get.swift
./validation-test/compiler_crashers_fixed/25432-abort.swift
./validation-test/compiler_crashers_fixed/01805-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/25996-llvm-bitstreamcursor-read.swift
./validation-test/compiler_crashers_fixed/26912-swift-patternbindingdecl-setpattern.swift
./validation-test/compiler_crashers_fixed/27030-std-function-func-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/28169-swift-parser-parsestmtreturn.swift
./validation-test/compiler_crashers_fixed/00218-swift-parser-parsegenericarguments.swift
./validation-test/compiler_crashers_fixed/26100-swift-protocoltype-canonicalizeprotocols.swift
./validation-test/compiler_crashers_fixed/26260-swift-abstractclosureexpr-setparams.swift
./validation-test/compiler_crashers_fixed/00091-swift-astprinter-printname.swift
./validation-test/compiler_crashers_fixed/00040-std-function-func-swift-constraints-solution-computesubstitutions.swift
./validation-test/compiler_crashers_fixed/27439-swift-funcdecl-setdeserializedsignature.swift
./validation-test/compiler_crashers_fixed/26518-swift-diagnosticengine-flushactivediagnostic.swift
./validation-test/compiler_crashers_fixed/28426-swift-expr-walk.swift
./validation-test/compiler_crashers_fixed/00415-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/28047-swift-constraints-constraintsystem-recordfix.swift
./validation-test/compiler_crashers_fixed/02184-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/01792-swift-genericsignature-get.swift
./validation-test/compiler_crashers_fixed/28456-unreachable-executed-at-swift-lib-ast-module-cpp-614.swift
./validation-test/compiler_crashers_fixed/01751-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/28108-swift-genericsignature-genericsignature.swift
./validation-test/compiler_crashers_fixed/01060-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/26869-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/28565-swift-constraints-constraintsystem-removeinactiveconstraint-swift-constraints-co.swift
./validation-test/compiler_crashers_fixed/27200-swift-abstractclosureexpr-setparams.swift
./validation-test/compiler_crashers_fixed/25403-swift-protocoltype-canonicalizeprotocols.swift
./validation-test/compiler_crashers_fixed/28505-failed-call-arguments-did-not-match-up.swift
./validation-test/compiler_crashers_fixed/26602-swift-astcontext-allocate.swift
./validation-test/compiler_crashers_fixed/28576-anonymous-namespace-findcapturedvars-checktype-swift-type-swift-sourceloc.swift
./validation-test/compiler_crashers_fixed/25599-swift-iterabledeclcontext-getmembers.swift
./validation-test/compiler_crashers_fixed/28326-swift-typebase-getmembersubstitutions.swift
./validation-test/compiler_crashers_fixed/27686-swift-conformancelookuptable-updatelookuptable.swift
./validation-test/compiler_crashers_fixed/27193-swift-typeloc-iserror.swift
./validation-test/compiler_crashers_fixed/28541-anonymous-namespace-verifier-walktodeclpost-swift-decl.swift
./validation-test/compiler_crashers_fixed/27835-llvm-tinyptrvector-swift-valuedecl-push-back.swift
./validation-test/compiler_crashers_fixed/25468-swift-genericsignature-get.swift
./validation-test/compiler_crashers_fixed/28480-unreachable-executed-at-swift-lib-sema-csdiag-cpp-6261.swift
./validation-test/compiler_crashers_fixed/26923-swift-typechecker-typecheckexpression.swift
./validation-test/compiler_crashers_fixed/26608-std-function-func.swift
./validation-test/compiler_crashers_fixed/28749-reftype-hastypeparameter-cannot-have-a-dependent-type-here.swift
./validation-test/compiler_crashers_fixed/01074-swift-lexer-getlocforendoftoken.swift
./validation-test/compiler_crashers_fixed/28157-swift-constraints-constraintsystem-solverstate-solverstate.swift
./validation-test/compiler_crashers_fixed/00684-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/26504-swift-lexer-leximpl.swift
./validation-test/compiler_crashers_fixed/01260-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/27763-swift-constraints-constraintgraph-computeconnectedcomponents.swift
./validation-test/compiler_crashers_fixed/26691-swift-serialization-serializer-writedecl.swift
./validation-test/compiler_crashers_fixed/26130-swift-tupletype-get.swift
./validation-test/compiler_crashers_fixed/27535-swift-diagnosticengine-flushactivediagnostic.swift
./validation-test/compiler_crashers_fixed/27977-swift-substitutedtype-get.swift
./validation-test/compiler_crashers_fixed/00853-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/28088-swift-nominaltypedecl-markinvalidgenericsignature.swift
./validation-test/compiler_crashers_fixed/26941-swift-typechecker-checkinheritanceclause.swift
./validation-test/compiler_crashers_fixed/26013-swift-parser-parseparameterclause.swift
./validation-test/compiler_crashers_fixed/25882-swift-genericparamlist-deriveallarchetypes.swift
./validation-test/compiler_crashers_fixed/27255-llvm-ondiskchainedhashtable-swift-modulefile-decltableinfo-find.swift
./validation-test/compiler_crashers_fixed/01635-swift-mangle-mangler-mangletype.swift
./validation-test/compiler_crashers_fixed/25567-swift-lexer-getlocforendoftoken.swift
./validation-test/compiler_crashers_fixed/27395-swift-nominaltypedecl-preparelookuptable.swift
./validation-test/compiler_crashers_fixed/25370-swift-genericsignature-get.swift
./validation-test/compiler_crashers_fixed/25453-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/00257-swift-partialgenerictypetoarchetyperesolver-resolvegenerictypeparamtype.swift
./validation-test/compiler_crashers_fixed/28859-resolver-unable-to-resolve-type-witness.swift
./validation-test/compiler_crashers_fixed/01120-clang-codegen-codegenfunction-emitlvalueforfield.swift
./validation-test/compiler_crashers_fixed/27002-swift-pattern-clone.swift
./validation-test/compiler_crashers_fixed/00644-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/28055-swift-parser-parsegetsetimpl.swift
./validation-test/compiler_crashers_fixed/26909-swift-constraints-constraintsystem-solverec.swift
./validation-test/compiler_crashers_fixed/00076-llvm-foldingset-swift-constraints-constraintlocator-nodeequals.swift
./validation-test/compiler_crashers_fixed/27727-swift-abstractclosureexpr-setparams.swift
./validation-test/compiler_crashers_fixed/28503-iscomplete-missing-inherited-mapping-in-conformance.swift
./validation-test/compiler_crashers_fixed/05045-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/00582-a.swift
./validation-test/compiler_crashers_fixed/01544-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/26631-swift-sourcemanager-getbytedistance.swift
./validation-test/compiler_crashers_fixed/00465-swift-typebase-isequal.swift
./validation-test/compiler_crashers_fixed/28469-segfault-0x4674de-0x464be6.swift
./validation-test/compiler_crashers_fixed/00391-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/27466-swift-lexer-lexidentifier.swift
./validation-test/compiler_crashers_fixed/27450-bool.swift
./validation-test/compiler_crashers_fixed/01595-swift-modulefile-gettype.swift
./validation-test/compiler_crashers_fixed/02052-swift-constraints-constraintsystem-getfixedtyperecursive.swift
./validation-test/compiler_crashers_fixed/28449-impl-getgraphindex-typevariables-size-out-of-bounds-index-failed.swift
./validation-test/compiler_crashers_fixed/00972-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/26429-getfileaux.swift
./validation-test/compiler_crashers_fixed/00876-x.swift
./validation-test/compiler_crashers_fixed/27282-swift-boundgenerictype-get.swift
./validation-test/compiler_crashers_fixed/28396-swift-lowering-silgenfunction-emitclosurevalue.swift
./validation-test/compiler_crashers_fixed/25510-swift-typechecker-getinterfacetypefrominternaltype.swift
./validation-test/compiler_crashers_fixed/27097-swift-constraints-constraintgraph-change-undo.swift
./validation-test/compiler_crashers_fixed/28524-swift-iterativetypechecker-issatisfied-swift-typecheckrequest.swift
./validation-test/compiler_crashers_fixed/00073-llvm-errs.swift
./validation-test/compiler_crashers_fixed/00401-swift-typechecker-checksubstitutions.swift
./validation-test/compiler_crashers_fixed/28051-swift-parser-parseexprimpl.swift
./validation-test/compiler_crashers_fixed/27562-swift-genericsignature-get.swift
./validation-test/compiler_crashers_fixed/27604-swift-valuedecl-getoverloadsignature.swift
./validation-test/compiler_crashers_fixed/26152-swift-diagnosticengine-emitdiagnostic.swift
./validation-test/compiler_crashers_fixed/26456-swift-lvaluetype-get.swift
./validation-test/compiler_crashers_fixed/01845-swift-typebase-gettypeofmember.swift
./validation-test/compiler_crashers_fixed/26902-swift-typechecker-resolvetypeincontext.swift
./validation-test/compiler_crashers_fixed/28374-swift-typechecker-resolvewitness.swift
./validation-test/compiler_crashers_fixed/28325-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/02169-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/28183-swift-typebase-isequal.swift
./validation-test/compiler_crashers_fixed/00252-swift-astcontext-getidentifier.swift
./validation-test/compiler_crashers_fixed/27970-swift-typechecker-typecheckbinding.swift
./validation-test/compiler_crashers_fixed/27357-swift-constraints-constraintsystem-lookupmember.swift
./validation-test/compiler_crashers_fixed/26503-swift-diagnosticengine-emitdiagnostic.swift
./validation-test/compiler_crashers_fixed/27500-swift-constructordecl-constructordecl.swift
./validation-test/compiler_crashers_fixed/25828-swift-archetypebuilder-finalize.swift
./validation-test/compiler_crashers_fixed/27270-swift-astcontext-loadextensions.swift
./validation-test/compiler_crashers_fixed/27544-bool.swift
./validation-test/compiler_crashers_fixed/01815-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/00356-swift-parser-parsegenericarguments.swift
./validation-test/compiler_crashers_fixed/00970-swift-diagnosticengine-flushactivediagnostic.swift
./validation-test/compiler_crashers_fixed/01669-void.swift
./validation-test/compiler_crashers_fixed/00554-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/00475-void.swift
./validation-test/compiler_crashers_fixed/27368-swift-modulefile-lookupvalue.swift
./validation-test/compiler_crashers_fixed/28618-unreachable-executed-at-swift-include-swift-ast-exprnodes-def-78.swift
./validation-test/compiler_crashers_fixed/26694-void.swift
./validation-test/compiler_crashers_fixed/01484-swift-constraints-constraintsystem-matchtypes.swift
./validation-test/compiler_crashers_fixed/00321-swift-typechecker-callwitness.swift
./validation-test/compiler_crashers_fixed/01377-swift-modulefile-gettype.swift
./validation-test/compiler_crashers_fixed/27233-swift-modulefile-loadextensions.swift
./validation-test/compiler_crashers_fixed/25011-swift-constraints-constraintsystem-opengeneric.swift
./validation-test/compiler_crashers_fixed/28774-swift-genericenvironment-queryinterfacetypesubstitutions-operator-swift-substitu.swift
./validation-test/compiler_crashers_fixed/27157-swift-type-transform.swift
./validation-test/compiler_crashers_fixed/00267-swift-parser-parseexprcallsuffix.swift
./validation-test/compiler_crashers_fixed/25507-void.swift
./validation-test/compiler_crashers_fixed/00871-swift-constraints-constraintsystem-matchtypes.swift
./validation-test/compiler_crashers_fixed/26212-swift-modulefile-getimportedmodules.swift
./validation-test/compiler_crashers_fixed/28034-swift-constraints-constraintsystem-diagnosefailureforexpr.swift
./validation-test/compiler_crashers_fixed/26442-swift-typebase-gatherallsubstitutions.swift
./validation-test/compiler_crashers_fixed/27490-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/28493-resolveidenttypecomponent-swift-typechecker-swift-declcontext-llvm-arrayref-swif.swift
./validation-test/compiler_crashers_fixed/26706-swift-constraints-constraintgraphscope-constraintgraphscope.swift
./validation-test/compiler_crashers_fixed/26496-swift-parser-skipsingle.swift
./validation-test/compiler_crashers_fixed/28130-swift-constraints-constraintsystem-solverscope-solverscope.swift
./validation-test/compiler_crashers_fixed/26690-swift-constraints-constraintsystem-simplifyconstraint.swift
./validation-test/compiler_crashers_fixed/26038-swift-parser-diagnose.swift
./validation-test/compiler_crashers_fixed/01651-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/28731-genericenv-nullptr-too-much-circularity.swift
./validation-test/compiler_crashers_fixed/00143-swift-parentype-get.swift
./validation-test/compiler_crashers_fixed/28767-ty-getnominalorboundgenericnominal-ty-is-dynamicselftype-ty-isexistentialtype-ty.swift
./validation-test/compiler_crashers_fixed/02098-llvm-smallvectorimpl-swift-diagnosticargument-operator.swift
./validation-test/compiler_crashers_fixed/27092-swift-typeloc-iserror.swift
./validation-test/compiler_crashers_fixed/00379-swift-type-transform.swift
./validation-test/compiler_crashers_fixed/00503-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/00136-swift-modulefile-getimportedmodules.swift
./validation-test/compiler_crashers_fixed/25733-swift-constraints-constraintsystem-solve.swift
./validation-test/compiler_crashers_fixed/27728-swift-modulefile-loadextensions.swift
./validation-test/compiler_crashers_fixed/26045-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/01820-cleanupillformedexpression.swift
./validation-test/compiler_crashers_fixed/01383-swift-clangmoduleunit-getimportedmodules.swift
./validation-test/compiler_crashers_fixed/26410-std-function-func-swift-typechecker-typecheckbinding.swift
./validation-test/compiler_crashers_fixed/01163-swift-declcontext-lookupqualified.swift
./validation-test/compiler_crashers_fixed/27750-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/26770-swift-protocoltype-get.swift
./validation-test/compiler_crashers_fixed/01158-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/26772-swift-sourcemanager-extracttext.swift
./validation-test/compiler_crashers_fixed/25461-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/28530-dc-closure-getparent-decl-context-isnt-correct.swift
./validation-test/compiler_crashers_fixed/00275-swift-parser-parseexprpostfix.swift
./validation-test/compiler_crashers_fixed/26805-void.swift
./validation-test/compiler_crashers_fixed/26659-swift-genericsignature-getcanonicalmanglingsignature.swift
./validation-test/compiler_crashers_fixed/28125-swift-constraints-constraint-createbindoverload.swift
./validation-test/compiler_crashers_fixed/26787-swift-declname-printpretty.swift
./validation-test/compiler_crashers_fixed/25934-swift-vardecl-getparentinitializer.swift
./validation-test/compiler_crashers_fixed/27871-swift-typechecker-typecheckpatternbinding.swift
./validation-test/compiler_crashers_fixed/02253-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/28596-unreachable-executed-at-swift-lib-sema-csapply-cpp-5466.swift
./validation-test/compiler_crashers_fixed/28372-swift-printoptions-setarchetypeanddynamicselftransform.swift
./validation-test/compiler_crashers_fixed/01412-swift-constraints-constraintlocator-profile.swift
./validation-test/compiler_crashers_fixed/01171-swift-parentype-get.swift
./validation-test/compiler_crashers_fixed/00438-swift-genericsignature-get.swift
./validation-test/compiler_crashers_fixed/28584-loc-isvalid.swift
./validation-test/compiler_crashers_fixed/00797-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/25420-swift-expr-walk.swift
./validation-test/compiler_crashers_fixed/27340-swift-constraints-constraintsystem-simplifytype.swift
./validation-test/compiler_crashers_fixed/26346-llvm-smallvectorimpl-swift-decl-insert.swift
./validation-test/compiler_crashers_fixed/28582-result-case-not-implemented.swift
./validation-test/compiler_crashers_fixed/26575-llvm-bitstreamcursor-read.swift
./validation-test/compiler_crashers_fixed/26273-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/27799-swift-modulefile-getimportedmodules.swift
./validation-test/compiler_crashers_fixed/01608-swift-lexer-getlocforendoftoken.swift
./validation-test/compiler_crashers_fixed/26957-swift-functiontype-get.swift
./validation-test/compiler_crashers_fixed/00534-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/26121-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/01309-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/01877-swift-typebase-isexistentialtype.swift
./validation-test/compiler_crashers_fixed/01533-vtable.swift
./validation-test/compiler_crashers_fixed/00144-swift-parser-consumetoken.swift
./validation-test/compiler_crashers_fixed/00283-swift-typebase-isspecialized.swift
./validation-test/compiler_crashers_fixed/01755-swift-streamprinter-printtext.swift
./validation-test/compiler_crashers_fixed/25456-swift-removeshadoweddecls.swift
./validation-test/compiler_crashers_fixed/00060-adjust-function-type.swift
./validation-test/compiler_crashers_fixed/01117-swift-declcontext-lookupqualified.swift
./validation-test/compiler_crashers_fixed/01305-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/00331-llvm-raw-fd-ostream-write-impl.swift
./validation-test/compiler_crashers_fixed/01014-swift-inouttype-get.swift
./validation-test/compiler_crashers_fixed/26668-swift-constraints-constraintsystem-diagnosefailureforexpr.swift
./validation-test/compiler_crashers_fixed/26715-swift-declname-printpretty.swift
./validation-test/compiler_crashers_fixed/26701-swift-genericparamlist-addnestedarchetypes.swift
./validation-test/compiler_crashers_fixed/28753-conforms-equivclass-conformsto-end.swift
./validation-test/compiler_crashers_fixed/28266-swift-moduledecl-lookupprefixoperator.swift
./validation-test/compiler_crashers_fixed/00128-swift-lexer-getlocforendoftoken.swift
./validation-test/compiler_crashers_fixed/27452-swift-nominaltypedecl-computetype.swift
./validation-test/compiler_crashers_fixed/02040-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/01465-swift-nominaltypedecl-computetype.swift
./validation-test/compiler_crashers_fixed/24864-std-function-func-swift-archetypebuilder-maptypeintocontext.swift
./validation-test/compiler_crashers_fixed/02057-swift-clangmoduleunit-getadaptermodule.swift
./validation-test/compiler_crashers_fixed/26438-swift-typebase-isequal.swift
./validation-test/compiler_crashers_fixed/26369-swift-substitutedtype-get.swift
./validation-test/compiler_crashers_fixed/26489-swift-parser-parseexpridentifier.swift
./validation-test/compiler_crashers_fixed/25889-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/27529-swift-typechecker-gettypeofrvalue.swift
./validation-test/compiler_crashers_fixed/27805-swift-markasobjc.swift
./validation-test/compiler_crashers_fixed/02115-vtable.swift
./validation-test/compiler_crashers_fixed/26540-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/28160-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/26928-swift-typebase-isequal.swift
./validation-test/compiler_crashers_fixed/27598-swift-typechecker-coercepatterntotype.swift
./validation-test/compiler_crashers_fixed/25807-swift-lexer-kindofidentifier.swift
./validation-test/compiler_crashers_fixed/25601-resolveidenttypecomponent.swift
./validation-test/compiler_crashers_fixed/28649-unreachable-executed-at-swift-lib-ast-type-cpp-1344.swift
./validation-test/compiler_crashers_fixed/25467-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/26864-std-function-func-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/00885-swift-parser-parseexprpostfix.swift
./validation-test/compiler_crashers_fixed/27274-swift-functiontype-get.swift
./validation-test/compiler_crashers_fixed/27946-swift-archetypebuilder-potentialarchetype-isbetterarchetypeanchor.swift
./validation-test/compiler_crashers_fixed/28159-swift-clangimporter-lookupvalue.swift
./validation-test/compiler_crashers_fixed/26922-swift-constraints-constraintsystem-opengeneric.swift
./validation-test/compiler_crashers_fixed/27425-swift-substitutedtype-get.swift
./validation-test/compiler_crashers_fixed/00859-x.swift
./validation-test/compiler_crashers_fixed/01939-swift-functiontype-get.swift
./validation-test/compiler_crashers_fixed/26469-swift-parser-parseexprpostfix.swift
./validation-test/compiler_crashers_fixed/27504-swift-typebase-getmembersubstitutions.swift
./validation-test/compiler_crashers_fixed/00454-swift-lexer-lexidentifier.swift
./validation-test/compiler_crashers_fixed/02246-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/00589-swift-diagnosticengine-diagnose.swift
./validation-test/compiler_crashers_fixed/26744-bool.swift
./validation-test/compiler_crashers_fixed/00813-swift-tupleexpr-create.swift
./validation-test/compiler_crashers_fixed/26119-swift-typeloc-iserror.swift
./validation-test/compiler_crashers_fixed/28662-isa-x-val-cast-ty-argument-of-incompatible-type.swift
./validation-test/compiler_crashers_fixed/28223-swift-type-transform.swift
./validation-test/compiler_crashers_fixed/00597-llvm-prettystacktraceentry-prettystacktraceentry.swift
./validation-test/compiler_crashers_fixed/27436-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/26163-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/28014-swift-decl-walk.swift
./validation-test/compiler_crashers_fixed/25811-swift-lexer-lexidentifier.swift
./validation-test/compiler_crashers_fixed/26887-swift-generictypeparamtype-get.swift
./validation-test/compiler_crashers_fixed/01076-swift-lexer-getlocforendoftoken.swift
./validation-test/compiler_crashers_fixed/27525-swift-constraints-constraintsystem-matchtupletypes.swift
./validation-test/compiler_crashers_fixed/27334-swift-archetypebuilder-potentialarchetype-getarchetypeanchor.swift
./validation-test/compiler_crashers_fixed/27671-llvm-smallvectorimpl-swift-diagnosticargument-operator.swift
./validation-test/compiler_crashers_fixed/00366-swift-constraints-constraintsystem-getfixedtyperecursive.swift
./validation-test/compiler_crashers_fixed/26980-swift-conformancelookuptable-lookupconformance.swift
./validation-test/compiler_crashers_fixed/25781-swift-parser-parseexprcallsuffix.swift
./validation-test/compiler_crashers_fixed/28278-swift-archetypebuilder-getgenericsignature.swift
./validation-test/compiler_crashers_fixed/00037-no-stacktrace.script.swift
./validation-test/compiler_crashers_fixed/28798-swift-genericenvironment-queryinterfacetypesubstitutions-operator-swift-substitu.swift
./validation-test/compiler_crashers_fixed/26357-swift-typechecker-validatetype.swift
./validation-test/compiler_crashers_fixed/01428-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/00244-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/27757-swift-parser-parsebraceitems.swift
./validation-test/compiler_crashers_fixed/26524-swift-functiontype-get.swift
./validation-test/compiler_crashers_fixed/25760-swift-inouttype-get.swift
./validation-test/compiler_crashers_fixed/01668-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/00969-swift-diagnosticengine-flushactivediagnostic.swift
./validation-test/compiler_crashers_fixed/26154-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/00592-swift-parser-parseexpridentifier.swift
./validation-test/compiler_crashers_fixed/27440-void.swift
./validation-test/compiler_crashers_fixed/27359-swift-valuedecl-settype.swift
./validation-test/compiler_crashers_fixed/27162-swift-type-transform.swift
./validation-test/compiler_crashers_fixed/01945-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/25564-swift-astprinter-printtextimpl.swift
./validation-test/compiler_crashers_fixed/28434-swift-type-transform.swift
./validation-test/compiler_crashers_fixed/27303-swift-typechecker-substituteinputsugartypeforresult.swift
./validation-test/compiler_crashers_fixed/25517-swift-typechecker-validatetype.swift
./validation-test/compiler_crashers_fixed/01446-swift-genericparamlist-deriveallarchetypes.swift
./validation-test/compiler_crashers_fixed/26378-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/27095-swift-nominaltypedecl-getmembers.swift
./validation-test/compiler_crashers_fixed/27584-swift-typechecker-isdeclavailable.swift
./validation-test/compiler_crashers_fixed/00729-swift-pattern-foreachvariable.swift
./validation-test/compiler_crashers_fixed/01101-swift-diagnosticengine-flushactivediagnostic.swift
./validation-test/compiler_crashers_fixed/26953-std-function-func-mapsignaturetype.swift
./validation-test/compiler_crashers_fixed/26986-swift-modulefile-maybereadforeignerrorconvention.swift
./validation-test/compiler_crashers_fixed/26303-llvm-llvm-unreachable-internal.swift
./validation-test/compiler_crashers_fixed/28162-swift-astcontext-addedexternaldecl.swift
./validation-test/compiler_crashers_fixed/27036-swift-astvisitor.swift
./validation-test/compiler_crashers_fixed/01150-void.swift
./validation-test/compiler_crashers_fixed/01123-swift-modulefile-lookupvalue.swift
./validation-test/compiler_crashers_fixed/01016-swift-genericsignature-get.swift
./validation-test/compiler_crashers_fixed/00693-swift-typechecker-validatetype.swift
./validation-test/compiler_crashers_fixed/27446-swift-conformancelookuptable-updatelookuptable.swift
./validation-test/compiler_crashers_fixed/01336-swift-archetypetype-setnestedtypes.swift
./validation-test/compiler_crashers_fixed/28643-swift-tupletype-get-llvm-arrayref-swift-tupletypeelt-swift-astcontext-const.swift
./validation-test/compiler_crashers_fixed/11093-swift-substitutedtype-get.swift
./validation-test/compiler_crashers_fixed/26673-llvm-triple-getosname.swift
./validation-test/compiler_crashers_fixed/01814-swift-constraints-constraintsystem-matchtypes.swift
./validation-test/compiler_crashers_fixed/25472-swift-typechecker-coercepatterntotype.swift
./validation-test/compiler_crashers_fixed/00477-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/25813-swift-diagnosticengine-flushactivediagnostic.swift
./validation-test/compiler_crashers_fixed/25511-swift-modulefile-gettype.swift
./validation-test/compiler_crashers_fixed/26952-swift-lexer-lexidentifier.swift
./validation-test/compiler_crashers_fixed/27263-swift-constraints-constraintgraphscope-constraintgraphscope.swift
./validation-test/compiler_crashers_fixed/28865-void-lookupinmodule-llvm-smallset-swift-cantype-4u-anonymous-namespace-sortcanty.swift
./validation-test/compiler_crashers_fixed/26025-swift-lexer-lexidentifier.swift
./validation-test/compiler_crashers_fixed/00689-b.swift
./validation-test/compiler_crashers_fixed/00742-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/26485-swift-constraints-constraintgraphnode-getadjacency.swift
./validation-test/compiler_crashers_fixed/00731-swift-typebase-isequal.swift
./validation-test/compiler_crashers_fixed/01144-swift-arrayslicetype-get.swift
./validation-test/compiler_crashers_fixed/26951-swift-modulefile-resolvecrossreference.swift
./validation-test/compiler_crashers_fixed/00641-swift-constraints-constraintsystem-solve.swift
./validation-test/compiler_crashers_fixed/01235-bool.swift
./validation-test/compiler_crashers_fixed/28346-swift-typebase-getdesugaredtype.swift
./validation-test/compiler_crashers_fixed/27582-swift-valuedecl-settype.swift
./validation-test/compiler_crashers_fixed/01623-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/00225-swift-classdecl-recordobjcmember.swift
./validation-test/compiler_crashers_fixed/28193-swift-typechecker-lookupmembertype.swift
./validation-test/compiler_crashers_fixed/27129-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/25154-swift-constraints-constraintsystem-opengeneric.swift
./validation-test/compiler_crashers_fixed/26393-swift-modulefile-gettype.swift
./validation-test/compiler_crashers_fixed/25794-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/25545-swift-parser-parsestmt.swift
./validation-test/compiler_crashers_fixed/00254-swift-typechecker-resolvetypeincontext.swift
./validation-test/compiler_crashers_fixed/01895-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/01009-swift-modulefile-getdecl.swift
./validation-test/compiler_crashers_fixed/28349-swift-typebase-gatherallsubstitutions.swift
./validation-test/compiler_crashers_fixed/26435-swift-arrayexpr-create.swift
./validation-test/compiler_crashers_fixed/01403-swift-modulefile-getdecl.swift
./validation-test/compiler_crashers_fixed/27380-swift-lexer-kindofidentifier.swift
./validation-test/compiler_crashers_fixed/28545-swift-archetypebuilder-potentialarchetype-gettype-swift-archetypebuilder.swift
./validation-test/compiler_crashers_fixed/26896-swift-diagnosticengine-emitdiagnostic.swift
./validation-test/compiler_crashers_fixed/25412-swift-sourcemanager-getbytedistance.swift
./validation-test/compiler_crashers_fixed/01288-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/26068-swift-archetypebuilder-addrequirement.swift
./validation-test/compiler_crashers_fixed/01105-void.swift
./validation-test/compiler_crashers_fixed/26394-swift-parser-parsedecl.swift
./validation-test/compiler_crashers_fixed/00702-swift-constraints-constraintsystem-matchtypes.swift
./validation-test/compiler_crashers_fixed/26477-swift-modulefile-getdecl.swift
./validation-test/compiler_crashers_fixed/27189-swift-archetypebuilder-maptypeintocontext.swift
./validation-test/compiler_crashers_fixed/00436-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/26184-llvm-yaml-input-preflightkey.swift
./validation-test/compiler_crashers_fixed/01466-swift-archetypetype-setnestedtypes.swift
./validation-test/compiler_crashers_fixed/28092-swift-parser-parseexpridentifier.swift
./validation-test/compiler_crashers_fixed/00752-swift-archetypebuilder-resolvearchetype.swift
./validation-test/compiler_crashers_fixed/02004-swift-diagnosticengine-flushactivediagnostic.swift
./validation-test/compiler_crashers_fixed/25562-swift-serialization-serializer-writedeclattribute.swift
./validation-test/compiler_crashers_fixed/00848-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/28827-type-ismaterializable-argument-to-setmustbematerializablerecursive-may-not-be-in.swift
./validation-test/compiler_crashers_fixed/26096-llvm-errs.swift
./validation-test/compiler_crashers_fixed/28748-genericenv-nullptr-too-much-circularity.swift
./validation-test/compiler_crashers_fixed/25671-swift-tuplepattern-create.swift
./validation-test/compiler_crashers_fixed/27960-swift-constraints-constraintsystem-opentype.swift
./validation-test/compiler_crashers_fixed/27739-swift-conformancelookuptable-resolveconformances.swift
./validation-test/compiler_crashers_fixed/01941-swift-optionaltype-get.swift
./validation-test/compiler_crashers_fixed/25970-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/00881-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/27007-swift-type-transform.swift
./validation-test/compiler_crashers_fixed/28355-swift-genericsignature-getsubstitutionmap.swift
./validation-test/compiler_crashers_fixed/25722-swift-unqualifiedlookup-unqualifiedlookup.swift
./validation-test/compiler_crashers_fixed/26742-swift-nominaltypedecl-prepareextensions.swift
./validation-test/compiler_crashers_fixed/27354-swift-typebase-getmembersubstitutions.swift
./validation-test/compiler_crashers_fixed/28385-swift-constraints-constraintgraph-addconstraint.swift
./validation-test/compiler_crashers_fixed/26881-std-function-func-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/25541-swift-lexer-getlocforendoftoken.swift
./validation-test/compiler_crashers_fixed/27698-swift-parser-parseexprimpl.swift
./validation-test/compiler_crashers_fixed/26591-swift-modulefile-getdeclcontext.swift
./validation-test/compiler_crashers_fixed/26230-swift-modulefile-getdeclcontext.swift
./validation-test/compiler_crashers_fixed/28433-swift-typechecker-typecheckdecl.swift
./validation-test/compiler_crashers_fixed/28085-swift-constraints-constraintsystem-simplifyrestrictedconstraint.swift
./validation-test/compiler_crashers_fixed/26238-swift-archetypebuilder-potentialarchetype-isbetterarchetypeanchor.swift
./validation-test/compiler_crashers_fixed/28280-swift-typechecker-resolveidentifiertype.swift
./validation-test/compiler_crashers_fixed/27752-swift-parser-parsebraceitems.swift
./validation-test/compiler_crashers_fixed/28841-swift-valuedecl-getformalaccessscope-swift-declcontext-const-bool-const.swift
./validation-test/compiler_crashers_fixed/25718-swift-genericsignature-genericsignature.swift
./validation-test/compiler_crashers_fixed/28412-swift-sourcefile-lookupcache-lookupclassmembers.swift
./validation-test/compiler_crashers_fixed/02113-swift-typechecker-resolvetypeincontext.swift
./validation-test/compiler_crashers_fixed/26637-swift-parser-skipsingle.swift
./validation-test/compiler_crashers_fixed/25609-swift-inouttype-get.swift
./validation-test/compiler_crashers_fixed/26834-swift-constraints-constraintsystem-generateconstraints.swift
./validation-test/compiler_crashers_fixed/01416-swift-constraints-constraintgraphscope-constraintgraphscope.swift
./validation-test/compiler_crashers_fixed/25693-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/01548-swift-typebase-getanyoptionalobjecttype.swift
./validation-test/compiler_crashers_fixed/02023-void.swift
./validation-test/compiler_crashers_fixed/28148-swift-constraints-constraintsystem-getconstraintlocator.swift
./validation-test/compiler_crashers_fixed/00626-swift-lexer-lexidentifier.swift
./validation-test/compiler_crashers_fixed/00116-swift-declname-printpretty.swift
./validation-test/compiler_crashers_fixed/28259-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/25553-swift-performexprdiagnostics.swift
./validation-test/compiler_crashers_fixed/28429-swift-decl-print.swift
./validation-test/compiler_crashers_fixed/00327-swift-typechecker-typecheckdecl.swift
./validation-test/compiler_crashers_fixed/28522-anonymous-namespace-verifier-walktostmtpost-swift-stmt.swift
./validation-test/compiler_crashers_fixed/01045-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/27302-swift-conformancelookuptable-conformancelookuptable.swift
./validation-test/compiler_crashers_fixed/28671-index-this-size-invalid-index.swift
./validation-test/compiler_crashers_fixed/00912-a.swift
./validation-test/compiler_crashers_fixed/01262-swift-modulefile-maybereadconformance.swift
./validation-test/compiler_crashers_fixed/01059-swift-constraints-constraintsystem-opengeneric.swift
./validation-test/compiler_crashers_fixed/01650-swift-typebase-getanyoptionalobjecttype.swift
./validation-test/compiler_crashers_fixed/25732-std-function-func-mapsignaturetype.swift
./validation-test/compiler_crashers_fixed/26530-llvm-foldingsetimpl-findnodeorinsertpos.swift
./validation-test/compiler_crashers_fixed/25596-swift-modulefile-getimportedmodules.swift
./validation-test/compiler_crashers_fixed/27137-swift-typechecker-coercepatterntotype.swift
./validation-test/compiler_crashers_fixed/26883-swift-modulefile-readmembers.swift
./validation-test/compiler_crashers_fixed/00548-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/27213-llvm-foldingset-swift-structtype-nodeequals.swift
./validation-test/compiler_crashers_fixed/00764-as.swift
./validation-test/compiler_crashers_fixed/28407-swift-genericsignature-getsubstitutionmap.swift
./validation-test/compiler_crashers_fixed/00704-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/27866-swift-typebase-getoptionalobjecttype.swift
./validation-test/compiler_crashers_fixed/28595-typeincontext-isnull-no-contextual-type-set-yet.swift
./validation-test/compiler_crashers_fixed/27814-swift-parser-parseexprclosure.swift
./validation-test/compiler_crashers_fixed/28046-swift-typechecker-substituteinputsugartypeforresult.swift
./validation-test/compiler_crashers_fixed/00717-swift-diagnosticengine-diagnose.swift
./validation-test/compiler_crashers_fixed/25676-swift-functiontype-get.swift
./validation-test/compiler_crashers_fixed/28415-swift-iterativetypechecker-processtypechecksuperclass.swift
./validation-test/compiler_crashers_fixed/25163-swift-constraints-constraintsystem-opengeneric.swift
./validation-test/compiler_crashers_fixed/00184-swift-modulefile-lookupvalue.swift
./validation-test/compiler_crashers_fixed/00108-swift-constraints-constraintsystem-lookthroughimplicitlyunwrappedoptionaltype.swift
./validation-test/compiler_crashers_fixed/02167-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/01390-swift-typebase-gettypevariables.swift
./validation-test/compiler_crashers_fixed/26368-swift-completegenerictyperesolver-resolvegenerictypeparamtype.swift
./validation-test/compiler_crashers_fixed/28246-swift-expr-propagatelvalueaccesskind.swift
./validation-test/compiler_crashers_fixed/26554-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/27515-swift-typechecker-overapproximateosversionsatlocation.swift
./validation-test/compiler_crashers_fixed/26985-swift-genericparamlist-addnestedarchetypes.swift
./validation-test/compiler_crashers_fixed/00907-c-t.swift
./validation-test/compiler_crashers_fixed/00467-llvm-foldingset-swift-tupletype-nodeequals.swift
./validation-test/compiler_crashers_fixed/28435-swift-genericenvironment-maptypeintocontext.swift
./validation-test/compiler_crashers_fixed/00227-swift-clangimporter-implementation-getknownobjcmethod.swift
./validation-test/compiler_crashers_fixed/27519-swift-pattern-buildforwardingrefexpr.swift
./validation-test/compiler_crashers_fixed/27837-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/26250-swift-constraints-constraintsystem-recordopenedtypes.swift
./validation-test/compiler_crashers_fixed/01066-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/00575-swift-typechecker-checksubstitutions.swift
./validation-test/compiler_crashers_fixed/00238-llvm-foldingsetnodeid-operator.swift
./validation-test/compiler_crashers_fixed/28166-swift-parser-parsedecl.swift
./validation-test/compiler_crashers_fixed/00384-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/26802-swift-lexer-kindofidentifier.swift
./validation-test/compiler_crashers_fixed/01519-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/02255-swift-genericsignature-get.swift
./validation-test/compiler_crashers_fixed/02198-std-function-func-swift-constraints-constraintsystem-simplifytype.swift
./validation-test/compiler_crashers_fixed/01619-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/26557-swift-expr-walk.swift
./validation-test/compiler_crashers_fixed/00667-swift-typedecl-getdeclaredtype.swift
./validation-test/compiler_crashers_fixed/25976-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/02177-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/01065-swift-constraints-constraintsystem-assignfixedtype.swift
./validation-test/compiler_crashers_fixed/27222-swift-typebase-getanyoptionalobjecttype.swift
./validation-test/compiler_crashers_fixed/25602-swift-protocoltype-canonicalizeprotocols.swift
./validation-test/compiler_crashers_fixed/26439-llvm-foldingset-swift-tupletype-nodeequals.swift
./validation-test/compiler_crashers_fixed/01211-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/25744-swift-sourcefile-lookupcache-lookupvalue.swift
./validation-test/compiler_crashers_fixed/02037-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/00561-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/01157-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/01967-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/28502-tok-isnot-tok-eof-lexing-past-eof.swift
./validation-test/compiler_crashers_fixed/27379-swift-constraints-constraintgraphnode-getadjacency.swift
./validation-test/compiler_crashers_fixed/25344-swift-modulefile-gettype.swift
./validation-test/compiler_crashers_fixed/00405-void.swift
./validation-test/compiler_crashers_fixed/01245-swift-typechecker-checksubstitutions.swift
./validation-test/compiler_crashers_fixed/00352-swift-archetypebuilder-resolvearchetype.swift
./validation-test/compiler_crashers_fixed/25916-swift-classtype-get.swift
./validation-test/compiler_crashers_fixed/27067-swift-valuedecl-settype.swift
./validation-test/compiler_crashers_fixed/25840-swift-valuedecl-overwritetype.swift
./validation-test/compiler_crashers_fixed/00991-swift-typebase-isequal.swift
./validation-test/compiler_crashers_fixed/26183-swift-constraints-constraintgraphnode-addconstraint.swift
./validation-test/compiler_crashers_fixed/01752-llvm-ondiskchainedhashtable-swift-modulefile-decltableinfo-find.swift
./validation-test/compiler_crashers_fixed/27378-swift-modulefile-maybereadpattern.swift
./validation-test/compiler_crashers_fixed/00976-swift-declcontext-lookupqualified.swift
./validation-test/compiler_crashers_fixed/01334-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/25830-swift-valuedecl-settype.swift
./validation-test/compiler_crashers_fixed/00053-std-function-func-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/26462-swift-modulefile-getdecl.swift
./validation-test/compiler_crashers_fixed/27326-swift-conformancelookuptable-updatelookuptable.swift
./validation-test/compiler_crashers_fixed/26728-swift-constraints-constraintlocator-profile.swift
./validation-test/compiler_crashers_fixed/00987-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/28337-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/26017-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/01291-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/00747-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/28322-swift-typechecker-resolvetypeincontext.swift
./validation-test/compiler_crashers_fixed/27033-swift-mangle-mangler-mangleidentifier.swift
./validation-test/compiler_crashers_fixed/25842-swift-diagnosticengine-diagnose.swift
./validation-test/compiler_crashers_fixed/01038-swift-constraints-constraintsystem-simplifyconstraint.swift
./validation-test/compiler_crashers_fixed/26148-swift-typebase-getmembersubstitutions.swift
./validation-test/compiler_crashers_fixed/02051-swift-tupletype-get.swift
./validation-test/compiler_crashers_fixed/28161-swift-constraints-constraintsystem-solvesingle.swift
./validation-test/compiler_crashers_fixed/01041-swift-declcontext-lookupqualified.swift
./validation-test/compiler_crashers_fixed/01782-llvm-ondiskchainedhashtable-swift-modulefile-decltableinfo-find.swift
./validation-test/compiler_crashers_fixed/27182-swift-lexer-leximpl.swift
./validation-test/compiler_crashers_fixed/00078-llvm-foldingset-swift-tupletype-nodeequals.swift
./validation-test/compiler_crashers_fixed/26634-swift-funcdecl-setdeserializedsignature.swift
./validation-test/compiler_crashers_fixed/01843-llvm-bitstreamcursor-readrecord.swift
./validation-test/compiler_crashers_fixed/28490-result-case-not-implemented.swift
./validation-test/compiler_crashers_fixed/27628-swift-abstractclosureexpr-setparams.swift
./validation-test/compiler_crashers_fixed/01183-swift-declcontext-lookupqualified.swift
./validation-test/compiler_crashers_fixed/26519-swift-lexer-lexstringliteral.swift
./validation-test/compiler_crashers_fixed/27605-swift-parser-parsedeclprotocol.swift
./validation-test/compiler_crashers_fixed/28097-swift-astprinter-printname.swift
./validation-test/compiler_crashers_fixed/28324-swift-diagnosticengine-emitdiagnostic.swift
./validation-test/compiler_crashers_fixed/26783-swift-lexer-kindofidentifier.swift
./validation-test/compiler_crashers_fixed/00770-swift-astvisitor.swift
./validation-test/compiler_crashers_fixed/00899-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/00761-swift-diagnosticengine-flushactivediagnostic.swift
./validation-test/compiler_crashers_fixed/26478-swift-archetypetype-resolvenestedtype.swift
./validation-test/compiler_crashers_fixed/27488-swift-conformancelookuptable-expandimpliedconformances.swift
./validation-test/compiler_crashers_fixed/01995-swift-constraints-constraintsystem-solve.swift
./validation-test/compiler_crashers_fixed/01057-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/25625-swift-typechecker-resolveinheritanceclause.swift
./validation-test/compiler_crashers_fixed/09385-swift-structtype-get.swift
./validation-test/compiler_crashers_fixed/26672-swift-diagnosticengine-flushactivediagnostic.swift
./validation-test/compiler_crashers_fixed/28620-type-mayhavemembers.swift
./validation-test/compiler_crashers_fixed/27207-swift-stmt-walk.swift
./validation-test/compiler_crashers_fixed/26046-swift-constraints-constraintgraph-change-undo.swift
./validation-test/compiler_crashers_fixed/01700-swift-modulefile-gettype.swift
./validation-test/compiler_crashers_fixed/27225-swift-polymorphicfunctiontype-get.swift
./validation-test/compiler_crashers_fixed/28465-child-source-range-not-contained-within-its-parent-guard-stmt.swift
./validation-test/compiler_crashers_fixed/28403-swift-genericsignature-getsubstitutionmap.swift
./validation-test/compiler_crashers_fixed/28776-type-should-have-type-checked-inheritance-clause-by-now.swift
./validation-test/compiler_crashers_fixed/27807-swift-scopeinfo-addtoscope.swift
./validation-test/compiler_crashers_fixed/28533-swift-unqualifiedlookup-unqualifiedlookup-swift-declname-swift-declcontext-swift.swift
./validation-test/compiler_crashers_fixed/00316-swift-genericparamlist-addnestedarchetypes.swift
./validation-test/compiler_crashers_fixed/00340-swift-parser-consumetoken.swift
./validation-test/compiler_crashers_fixed/00046-swift-archetypebuilder-potentialarchetype-getnestedtype.timeout.swift
./validation-test/compiler_crashers_fixed/26385-swift-typevariabletype-implementation-assignfixedtype.swift
./validation-test/compiler_crashers_fixed/25797-void.swift
./validation-test/compiler_crashers_fixed/26588-swift-genericparamlist-create.swift
./validation-test/compiler_crashers_fixed/27611-swift-parser-parsegetsetimpl.swift
./validation-test/compiler_crashers_fixed/26512-swift-iterabledeclcontext-getmembers.swift
./validation-test/compiler_crashers_fixed/27950-swift-unqualifiedlookup-unqualifiedlookup.swift
./validation-test/compiler_crashers_fixed/13737-swift-availabilityattr-isunavailable.swift
./validation-test/compiler_crashers_fixed/28009-swift-parser-parsedeclenum.swift
./validation-test/compiler_crashers_fixed/28821-isa-protocoldecl-nominal-cannot-be-a-protocol.swift
./validation-test/compiler_crashers_fixed/28652-anonymous-namespace-verifier-verifychecked-swift-type-llvm-smallptrset-swift-arc.swift
./validation-test/compiler_crashers_fixed/25568-swift-diagnosticengine-flushactivediagnostic.swift
./validation-test/compiler_crashers_fixed/26280-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/26686-swift-substitutedtype-get.swift
./validation-test/compiler_crashers_fixed/28354-swift-conformancelookuptable-lookupconformances.swift
./validation-test/compiler_crashers_fixed/28612-val-isa-used-on-a-null-pointer.swift
./validation-test/compiler_crashers_fixed/26648-swift-lexer-lexidentifier.swift
./validation-test/compiler_crashers_fixed/26145-swift-lexer-getlocforendoftoken.swift
./validation-test/compiler_crashers_fixed/26411-llvm-smallvectorimpl-swift-diagnosticargument-operator.swift
./validation-test/compiler_crashers_fixed/28610-elements-size-1-even-number-of-elements-in-sequence.swift
./validation-test/compiler_crashers_fixed/28127-swift-typebase-getmembersubstitutions.swift
./validation-test/compiler_crashers_fixed/02144-swift-parser-parsestmt.swift
./validation-test/compiler_crashers_fixed/01618-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/25632-swift-stmt-walk.swift
./validation-test/compiler_crashers_fixed/28418-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/27635-swift-protocoltype-canonicalizeprotocols.swift
./validation-test/compiler_crashers_fixed/01554-swift-typealiasdecl-typealiasdecl.swift
./validation-test/compiler_crashers_fixed/01885-swift-constraints-solution-simplifytype.swift
./validation-test/compiler_crashers_fixed/24879-getmemberforbasetype.swift
./validation-test/compiler_crashers_fixed/26851-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/26778-firsttarget.swift
./validation-test/compiler_crashers_fixed/26898-swift-abstractclosureexpr-setparams.swift
./validation-test/compiler_crashers_fixed/28019-swift-typechecker-checkdeclarationavailability.swift
./validation-test/compiler_crashers_fixed/00149-swift-typechecker-callwitness.swift
./validation-test/compiler_crashers_fixed/25443-swift-parser-parsedecl.swift
./validation-test/compiler_crashers_fixed/26104-swift-vardecl-getparentinitializer.swift
./validation-test/compiler_crashers_fixed/26574-std-function-func-swift-constraints-constraintsystem-simplifytype.swift
./validation-test/compiler_crashers_fixed/01593-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/02008-swift-tupletype-get.swift
./validation-test/compiler_crashers_fixed/00790-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/27037-swift-nominaltype-get.swift
./validation-test/compiler_crashers_fixed/27963-swift-typechecker-checkunsupportedprotocoltype.swift
./validation-test/compiler_crashers_fixed/00518-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/26227-swift-lexer-lexoperatoridentifier.swift
./validation-test/compiler_crashers_fixed/27341-swift-conformancelookuptable-getallprotocols.swift
./validation-test/compiler_crashers_fixed/01957-swift-typechecker-resolvetypeincontext.swift
./validation-test/compiler_crashers_fixed/00206-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/26908-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/28309-swift-typechecker-addimplicitconstructors.swift
./validation-test/compiler_crashers_fixed/26127-swift-modulefile-gettype.swift
./validation-test/compiler_crashers_fixed/00864-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/01098-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/01781-swift-optional-std-pair-swift-api-notes-contextid.swift
./validation-test/compiler_crashers_fixed/25667-swift-genericsignature-genericsignature.swift
./validation-test/compiler_crashers_fixed/00216-swift-unqualifiedlookup-unqualifiedlookup.swift
./validation-test/compiler_crashers_fixed/00895-swift-tuplepattern-create.swift
./validation-test/compiler_crashers_fixed/27885-bool.swift
./validation-test/compiler_crashers_fixed/00835-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/01025-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/26633-swift-constraints-constraintsystem-applysolutionshallow.swift
./validation-test/compiler_crashers_fixed/00470-swift-constraints-constraintsystem-simplifyconstraint.swift
./validation-test/compiler_crashers_fixed/25417-swift-inouttype-get.swift
./validation-test/compiler_crashers_fixed/27889-void.swift
./validation-test/compiler_crashers_fixed/00457-swift-declcontext-lookupqualified.swift
./validation-test/compiler_crashers_fixed/00222-swift-modulefile-modulefile.swift
./validation-test/compiler_crashers_fixed/02178-swift-lexer-leximpl.swift
./validation-test/compiler_crashers_fixed/00913-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/26107-llvm-foldingset-swift-structtype-nodeequals.swift
./validation-test/compiler_crashers_fixed/27776-swift-unqualifiedlookup-unqualifiedlookup.swift
./validation-test/compiler_crashers_fixed/27367-swift-boundgenerictype-getsubstitutions.swift
./validation-test/compiler_crashers_fixed/01711-swift-module-lookupvalue.swift
./validation-test/compiler_crashers_fixed/00957-void.swift
./validation-test/compiler_crashers_fixed/26831-llvm-densemapbase-llvm-smalldensemap-swift-typevariabletype.swift
./validation-test/compiler_crashers_fixed/01103-swift-unboundgenerictype-get.swift
./validation-test/compiler_crashers_fixed/27934-swift-genericsignature-getcanonical.swift
./validation-test/compiler_crashers_fixed/00781-swift-constraints-constraintsystem-diagnosefailurefromconstraints.swift
./validation-test/compiler_crashers_fixed/01459-swift-abstractstoragedecl-makecomputed.swift
./validation-test/compiler_crashers_fixed/27309-swift-constraints-constraintgraph-computeconnectedcomponents.swift
./validation-test/compiler_crashers_fixed/26153-swift-astprinter-printtextimpl.swift
./validation-test/compiler_crashers_fixed/00223-swift-stringliteralexpr-stringliteralexpr.swift
./validation-test/compiler_crashers_fixed/22725-swift-constraints-constraintsystem-solvesimplified.swift
./validation-test/compiler_crashers_fixed/01271-swift-parser-parseexprunary.swift
./validation-test/compiler_crashers_fixed/27415-swift-namelookup-lookupinmodule.swift
./validation-test/compiler_crashers_fixed/27258-swift-abstractclosureexpr-setparams.swift
./validation-test/compiler_crashers_fixed/00513-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/27574-llvm-foldingset-swift-tupletype-nodeequals.swift
./validation-test/compiler_crashers_fixed/27315-swift-tupletype-get.swift
./validation-test/compiler_crashers_fixed/27187-swift-protocoltype-canonicalizeprotocols.swift
./validation-test/compiler_crashers_fixed/26335-swift-parser-parsedeclenumcase.swift
./validation-test/compiler_crashers_fixed/28757-conformance-getwitness-requirement-nullptr-getdecl-match-witness-deduced-differe.swift
./validation-test/compiler_crashers_fixed/01332-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/25843-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/00334-swift-astvisitor.swift
./validation-test/compiler_crashers_fixed/27541-swift-modulefile-maybereadgenericparams.swift
./validation-test/compiler_crashers_fixed/25846-swift-typechecker-checkinheritanceclause.swift
./validation-test/compiler_crashers_fixed/26342-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/02250-swift-parser-parsetoken.swift
./validation-test/compiler_crashers_fixed/01369-swift-modulefile-getdecl.swift
./validation-test/compiler_crashers_fixed/28700-isactuallycanonicalornull-forming-a-cantype-out-of-a-non-canonical-type.swift
./validation-test/compiler_crashers_fixed/00537-swift-constraints-solution-computesubstitutions.swift
./validation-test/compiler_crashers_fixed/00511-swift-constraints-constraintlocator-profile.swift
./validation-test/compiler_crashers_fixed/01490-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/26652-std-function-func-mapsignaturetype.swift
./validation-test/compiler_crashers_fixed/25829-swift-typebase-getanyoptionalobjecttype.swift
./validation-test/compiler_crashers_fixed/02026-swift-pattern-foreachvariable.swift
./validation-test/compiler_crashers_fixed/27760-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/00649-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/27740-swift-modulefile-getdeclcontext.swift
./validation-test/compiler_crashers_fixed/27407-swift-constraints-simplifylocator.swift
./validation-test/compiler_crashers_fixed/01873-swift-pattern-foreachvariable.swift
./validation-test/compiler_crashers_fixed/27433-std-function-func-swift-parser-parsenominaldeclmembers.swift
./validation-test/compiler_crashers_fixed/00906-swift-constraints-constraintsystem-getfixedtyperecursive.swift
./validation-test/compiler_crashers_fixed/25990-swift-sourcemanager-extracttext.swift
./validation-test/compiler_crashers_fixed/28680-swift-typebase-getdesugaredtype.swift
./validation-test/compiler_crashers_fixed/25493-swift-sourcemanager-getbytedistance.swift
./validation-test/compiler_crashers_fixed/00603-swift-constraints-constraintsystem-getfixedtyperecursive.swift
./validation-test/compiler_crashers_fixed/00107-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/00587-swift-pattern-foreachvariable.swift
./validation-test/compiler_crashers_fixed/27827-swift-constraints-simplifylocator.swift
./validation-test/compiler_crashers_fixed/01413-std-function-func-swift-constraints-constraintsystem-simplifytype.swift
./validation-test/compiler_crashers_fixed/26906-swift-declcontext-isclassorclassextensioncontext.swift
./validation-test/compiler_crashers_fixed/27898-void.swift
./validation-test/compiler_crashers_fixed/01448-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/25771-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/25898-swift-parser-parsedeclinit.swift
./validation-test/compiler_crashers_fixed/27783-swift-genericparamlist-deriveallarchetypes.swift
./validation-test/compiler_crashers_fixed/26653-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/26047-swift-genericsignature-get.swift
./validation-test/compiler_crashers_fixed/25424-swift-typechecker-computeaccessibility.swift
./validation-test/compiler_crashers_fixed/25701-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/00458-swift-declcontext-lookupqualified.swift
./validation-test/compiler_crashers_fixed/00852-void.swift
./validation-test/compiler_crashers_fixed/26801-swift-lexer-leximpl.swift
./validation-test/compiler_crashers_fixed/02206-void.swift
./validation-test/compiler_crashers_fixed/26776-swift-typebase-getanyoptionalobjecttype.swift
./validation-test/compiler_crashers_fixed/01943-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/25917-void.swift
./validation-test/compiler_crashers_fixed/28569-swift-declcontext-getastypeortypeextensioncontext-const.swift
./validation-test/compiler_crashers_fixed/26268-swift-lexer-lexidentifier.swift
./validation-test/compiler_crashers_fixed/28504-anonymous-namespace-verifier-verifychecked-swift-type-llvm-smallptrset-swift-arc.swift
./validation-test/compiler_crashers_fixed/00148-swift-parser-parseexprunary.swift
./validation-test/compiler_crashers_fixed/28316-swift-typechecker-checkgenericparamlist.swift
./validation-test/compiler_crashers_fixed/25648-swift-typechecker-overapproximateosversionsatlocation.swift
./validation-test/compiler_crashers_fixed/01313-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/26571-swift-constraints-constraintsystem-recordopenedtypes.swift
./validation-test/compiler_crashers_fixed/25909-swift-constraints-solution-simplifytype.swift
./validation-test/compiler_crashers_fixed/00543-swift-nominaltypedecl-computeinterfacetype.swift
./validation-test/compiler_crashers_fixed/00380-swift-lexer-lexidentifier.swift
./validation-test/compiler_crashers_fixed/00801-swift-typechecker-checksubstitutions.swift
./validation-test/compiler_crashers_fixed/26162-swift-constraints-constraintsystem-getconstraintlocator.swift
./validation-test/compiler_crashers_fixed/00105-swift-constraints-constraintsystem-getconstraintlocator.swift
./validation-test/compiler_crashers_fixed/00339-swift-clangimporter-implementation-mapselectortodeclname.swift
./validation-test/compiler_crashers_fixed/01214-std-function-func-swift-constraints-constraintsystem-simplifytype.swift
./validation-test/compiler_crashers_fixed/27587-llvm-foldingset-swift-classtype-nodeequals.swift
./validation-test/compiler_crashers_fixed/01520-llvm-bitstreamcursor-readrecord.swift
./validation-test/compiler_crashers_fixed/27438-swift-typechecker-checkinheritanceclause.swift
./validation-test/compiler_crashers_fixed/25530-swift-diagnosticengine-flushactivediagnostic.swift
./validation-test/compiler_crashers_fixed/26930-swift-constraints-constraintgraph-change-undo.swift
./validation-test/compiler_crashers_fixed/28743-swift-typechecker-substmembertypewithbase-swift-moduledecl-swift-typedecl-swift-.swift
./validation-test/compiler_crashers_fixed/00782-d.swift
./validation-test/compiler_crashers_fixed/28796-result-second.swift
./validation-test/compiler_crashers_fixed/01702-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/00910-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/00446-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/00774-unowned.swift
./validation-test/compiler_crashers_fixed/01998-swift-tupletype-get.swift
./validation-test/compiler_crashers_fixed/27905-swift-constraints-constraintgraph-change-undo.swift
./validation-test/compiler_crashers_fixed/00133-swift-typechecker-resolvetypeincontext.swift
./validation-test/compiler_crashers_fixed/01236-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/27301-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/02135-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/00576-llvm-errs.swift
./validation-test/compiler_crashers_fixed/28367-swift-declcontext-isgenericcontext.swift
./validation-test/compiler_crashers_fixed/26669-swift-typechecker-overapproximateosversionsatlocation.swift
./validation-test/compiler_crashers_fixed/28711-anonymous-namespace-findcapturedvars-checktype-swift-type-swift-sourceloc.swift
./validation-test/compiler_crashers_fixed/26174-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/25523-swift-constraints-constraintsystem-diagnosefailureforexpr.swift
./validation-test/compiler_crashers_fixed/02199-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/25382-swift-typechecker-overapproximateosversionsatlocation.swift
./validation-test/compiler_crashers_fixed/01762-swift-constraints-constraintsystem-opengeneric.swift
./validation-test/compiler_crashers_fixed/28633-typevariables-impl-getgraphindex-typevar-type-variable-mismatch.swift
./validation-test/compiler_crashers_fixed/27094-resolveidenttypecomponent.swift
./validation-test/compiler_crashers_fixed/27209-swift-type-transform.swift
./validation-test/compiler_crashers_fixed/26826-swift-constraints-constraintsystem-solvesimplified.swift
./validation-test/compiler_crashers_fixed/01944-swift-type-print.swift
./validation-test/compiler_crashers_fixed/01230-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/28628-gettype-e-isassignabletype-setting-access-kind-on-non-l-value.swift
./validation-test/compiler_crashers_fixed/01168-swift-constraints-solution-solution.swift
./validation-test/compiler_crashers_fixed/25786-void.swift
./validation-test/compiler_crashers_fixed/01594-swift-genericfunctiontype-get.swift
./validation-test/compiler_crashers_fixed/25535-swift-astvisitor.swift
./validation-test/compiler_crashers_fixed/00423-swift-archetypebuilder-resolvearchetype.swift
./validation-test/compiler_crashers_fixed/00830-void.swift
./validation-test/compiler_crashers_fixed/27086-llvm-bitstreamcursor-read.swift
./validation-test/compiler_crashers_fixed/27130-swift-typechecker-validatetype.swift
./validation-test/compiler_crashers_fixed/26536-std-function-func-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/26676-swift-parser-parsetoken.swift
./validation-test/compiler_crashers_fixed/27843-llvm-foldingset-swift-classtype-nodeequals.swift
./validation-test/compiler_crashers_fixed/25770-llvm-foldingset-swift-tupletype-nodeequals.swift
./validation-test/compiler_crashers_fixed/02254-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/27839-swift-archetypebuilder-potentialarchetype-addconformance.swift
./validation-test/compiler_crashers_fixed/00390-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/28677-isactuallycanonicalornull-forming-a-cantype-out-of-a-non-canonical-type.swift
./validation-test/compiler_crashers_fixed/25617-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/28542-swift-genericsignature-getsubstitutionmap-llvm-arrayref-swift-substitution-swift.swift
./validation-test/compiler_crashers_fixed/25578-swift-parser-parsedeclvar.swift
./validation-test/compiler_crashers_fixed/27360-swift-modulefile-gettype.swift
./validation-test/compiler_crashers_fixed/01226-swift-modulefile-gettype.swift
./validation-test/compiler_crashers_fixed/25152-swift-typechecker-resolvetypeincontext.swift
./validation-test/compiler_crashers_fixed/27876-filtervalues.swift
./validation-test/compiler_crashers_fixed/00211-swift-completegenerictyperesolver-resolvedependentmembertype.swift
./validation-test/compiler_crashers_fixed/26514-swift-parser-skipsingle.swift
./validation-test/compiler_crashers_fixed/01617-swift-scopeinfo-addtoscope.swift
./validation-test/compiler_crashers_fixed/28251-swift-typechecker-addimplicitconstructors.swift
./validation-test/compiler_crashers_fixed/00847-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/28779-parent-parent-is-nominaltype-parent-is-boundgenerictype-parent-is-unboundgeneric.swift
./validation-test/compiler_crashers_fixed/01406-swift-nominaltypedecl-computetype.swift
./validation-test/compiler_crashers_fixed/27518-llvm-foldingset-swift-genericfunctiontype-nodeequals.swift
./validation-test/compiler_crashers_fixed/01632-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/28687-unreachable-executed-at-swift-lib-ast-type-cpp-1349.swift
./validation-test/compiler_crashers_fixed/00568-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/28174-swift-constraints-constraintsystem-simplify.swift
./validation-test/compiler_crashers_fixed/26179-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/25991-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/27521-swift-parser-parseexprpostfix.swift
./validation-test/compiler_crashers_fixed/26377-swift-astcontext-allocate.swift
./validation-test/compiler_crashers_fixed/26098-swift-funcdecl-setdeserializedsignature.swift
./validation-test/compiler_crashers_fixed/02213-llvm-smallptrsetimplbase-smallptrsetimplbase.swift
./validation-test/compiler_crashers_fixed/27038-swift-constraints-constraintsystem-matchtypes.swift
./validation-test/compiler_crashers_fixed/01182-swift-declcontext-lookupqualified.swift
./validation-test/compiler_crashers_fixed/01920-swift-completegenerictyperesolver-resolvedependentmembertype.swift
./validation-test/compiler_crashers_fixed/25502-swift-typedecl-getdeclaredinterfacetype.swift
./validation-test/compiler_crashers_fixed/28676-anonymous-namespace-findcapturedvars-checktype-swift-type-swift-sourceloc.swift
./validation-test/compiler_crashers_fixed/27058-llvm-optional-swift-diagnostic-operator.swift
./validation-test/compiler_crashers_fixed/26170-swift-parser-skipsingle.swift
./validation-test/compiler_crashers_fixed/01029-swift-modulefile-maybereadgenericparams.swift
./validation-test/compiler_crashers_fixed/00619-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/26507-swift-sourcemanager-extracttext.swift
./validation-test/compiler_crashers_fixed/27806-swift-declcontext-lookupqualified.swift
./validation-test/compiler_crashers_fixed/27878-swift-expr-walk.swift
./validation-test/compiler_crashers_fixed/26932-swift-typebase-isequal.swift
./validation-test/compiler_crashers_fixed/27939-vtable.swift
./validation-test/compiler_crashers_fixed/00166-swift-typebase-isequal.swift
./validation-test/compiler_crashers_fixed/00553-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/00284-swift-modulefile-maybereadconformance.swift
./validation-test/compiler_crashers_fixed/27134-swift-structtype-get.swift
./validation-test/compiler_crashers_fixed/00291-swift-clangmoduleunit-lookupvalue.swift
./validation-test/compiler_crashers_fixed/01188-swift-genericfunctiontype-get.swift
./validation-test/compiler_crashers_fixed/28025-swift-markasobjc.swift
./validation-test/compiler_crashers_fixed/27558-swift-parser-parsetypeidentifier.swift
./validation-test/compiler_crashers_fixed/26054-swift-lexer-leximpl.swift
./validation-test/compiler_crashers_fixed/26966-swift-parentype-get.swift
./validation-test/compiler_crashers_fixed/01197-swift-typechecker-validatetype.swift
./validation-test/compiler_crashers_fixed/01660-swift-parser-parseexprsequence.swift
./validation-test/compiler_crashers_fixed/26818-swift-typechecker-coercepatterntotype.swift
./validation-test/compiler_crashers_fixed/00376-void.swift
./validation-test/compiler_crashers_fixed/26905-swift-type-transform.swift
./validation-test/compiler_crashers_fixed/00308-llvm-raw-ostream-write.swift
./validation-test/compiler_crashers_fixed/28064-swift-stmtconditionelement-walk.swift
./validation-test/compiler_crashers_fixed/02174-swift-modulefile-lookupvalue.swift
./validation-test/compiler_crashers_fixed/26479-swift-parser-applyattributetotype.swift
./validation-test/compiler_crashers_fixed/26266-swift-typechecker-getinterfacetypefrominternaltype.swift
./validation-test/compiler_crashers_fixed/00259-swift-lexer-leximpl.swift
./validation-test/compiler_crashers_fixed/26397-swift-sourcemanager-extracttext.swift
./validation-test/compiler_crashers_fixed/26551-swift-protocoltype-canonicalizeprotocols.swift
./validation-test/compiler_crashers_fixed/25709-swift-lexer-leximpl.swift
./validation-test/compiler_crashers_fixed/28436-swift-typechecker-typecheckdecl.swift
./validation-test/compiler_crashers_fixed/28022-swift-typechecker-diagnoseexplicitunavailability.swift
./validation-test/compiler_crashers_fixed/28765-inprotocol-isrequirementsignaturecomputed-missing-signature.swift
./validation-test/compiler_crashers_fixed/01919-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/26711-swift-constraints-constraintsystem-addtypevariableconstraintstoworklist.swift
./validation-test/compiler_crashers_fixed/00902-c.swift
./validation-test/compiler_crashers_fixed/00880-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/28221-swift-typebase-getmembersubstitutions.swift
./validation-test/compiler_crashers_fixed/25638-swift-modulefile-gettype.swift
./validation-test/compiler_crashers_fixed/28797-declbits-beingvalidated-ibv.swift
./validation-test/compiler_crashers_fixed/02132-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/01572-swift-constraints-solution-solution.swift
./validation-test/compiler_crashers_fixed/27661-std-function-func-swift-constraints-constraintsystem-simplifytype.swift
./validation-test/compiler_crashers_fixed/01750-swift-modulefile-gettype.swift
./validation-test/compiler_crashers_fixed/26872-std-function-func.swift
./validation-test/compiler_crashers_fixed/01330-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/25425-swift-parser-parsedecl.swift
./validation-test/compiler_crashers_fixed/28467-child-source-range-not-contained-within-its-parent-guard-stmt.swift
./validation-test/compiler_crashers_fixed/26291-swift-diagnosticengine-emitdiagnostic.swift
./validation-test/compiler_crashers_fixed/26247-swift-constraints-constraintsystem-matchtypes.swift
./validation-test/compiler_crashers_fixed/28216-swift-expr-propagatelvalueaccesskind.swift
./validation-test/compiler_crashers_fixed/01844-swift-constraints-constraintsystem-assignfixedtype.swift
./validation-test/compiler_crashers_fixed/27364-swift-typechecker-conformstoprotocol.swift
./validation-test/compiler_crashers_fixed/01082-llvm-foldingsetnodeid-operator.swift
./validation-test/compiler_crashers_fixed/26938-swift-diagnosticengine-flushactivediagnostic.swift
./validation-test/compiler_crashers_fixed/28342-getpointerelementtype-is-not-storagetype.swift
./validation-test/compiler_crashers_fixed/27224-swift-constraints-constraintgraph-gatherconstraints.swift
./validation-test/compiler_crashers_fixed/26522-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/00426-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/00146-swift-parser-parseexpridentifier.swift
./validation-test/compiler_crashers_fixed/01189-swift-optional-swift-diagnostic-operator.swift
./validation-test/compiler_crashers_fixed/02047-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/28727-objectty-haserror-cannot-have-errortype-wrapped-inside-lvaluetype.swift
./validation-test/compiler_crashers_fixed/28871-nested-second-nested-second-isequal-result-nested-second-haserror-result-haserro.swift
./validation-test/compiler_crashers_fixed/25930-swift-parser-parsetoken.swift
./validation-test/compiler_crashers_fixed/00736-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/25398-swift-serialization-serializer-writenormalconformance.swift
./validation-test/compiler_crashers_fixed/00507-std-basic-string-char.swift
./validation-test/compiler_crashers_fixed/28290-swift-constraints-constraintsystem-diagnosefailureforexpr.swift
./validation-test/compiler_crashers_fixed/27568-swift-polymorphicfunctiontype-get.swift
./validation-test/compiler_crashers_fixed/00961-bool.swift
./validation-test/compiler_crashers_fixed/27591-swift-modulefile-gettype.swift
./validation-test/compiler_crashers_fixed/27613-swift-patternbindingdecl-hasstorage.swift
./validation-test/compiler_crashers_fixed/00911-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/25877-firsttarget.swift
./validation-test/compiler_crashers_fixed/00281-void.swift
./validation-test/compiler_crashers_fixed/28718-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/26072-swift-lexer-leximpl.swift
./validation-test/compiler_crashers_fixed/28613-matchcanfail-failed-call-arguments-did-not-match-up.swift
./validation-test/compiler_crashers_fixed/24800-swift-constraints-constraintsystem-matchsuperclasstypes.swift
./validation-test/compiler_crashers_fixed/27645-swift-typechecker-lookupunqualified.swift
./validation-test/compiler_crashers_fixed/28272-swift-expr-walk.swift
./validation-test/compiler_crashers_fixed/01104-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/00099-swift-constraints-constraintgraph-change-undo.swift
./validation-test/compiler_crashers_fixed/28457-unreachable-executed-at-swift-include-swift-ast-cantypevisitor-h-41.swift
./validation-test/compiler_crashers_fixed/26024-std-function-func-mapsignaturetype.swift
./validation-test/compiler_crashers_fixed/25989-std-function-func-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/00082-std-function-func-containsprotocolself.swift
./validation-test/compiler_crashers_fixed/00739-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/26141-swift-lexer-getlocforendoftoken.swift
./validation-test/compiler_crashers_fixed/27794-swift-constraints-constraintlocator-profile.swift
./validation-test/compiler_crashers_fixed/26243-swift-parser-consumeidentifier.swift
./validation-test/compiler_crashers_fixed/27520-swift-typechecker-substituteinputsugartypeforresult.swift
./validation-test/compiler_crashers_fixed/27706-swift-availabilityinference-applyinferredavailableattrs.swift
./validation-test/compiler_crashers_fixed/28653-child-source-range-not-contained-within-its-parent.swift
./validation-test/compiler_crashers_fixed/02042-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/26520-swift-typechecker-checkgenericarguments.swift
./validation-test/compiler_crashers_fixed/27369-swift-type-transform.swift
./validation-test/compiler_crashers_fixed/02150-swift-typechecker-coercepatterntotype.swift
./validation-test/compiler_crashers_fixed/01489-swift-lexer-lexidentifier.swift
./validation-test/compiler_crashers_fixed/26658-swift-parser-skipsingle.swift
./validation-test/compiler_crashers_fixed/28037-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/27769-swift-patternbindingdecl-create.swift
./validation-test/compiler_crashers_fixed/27054-void.swift
./validation-test/compiler_crashers_fixed/01231-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/02018-swift-declname-printpretty.swift
./validation-test/compiler_crashers_fixed/01674-swift-constraints-constraintsystem-simplifyconstraint.swift
./validation-test/compiler_crashers_fixed/01675-swift-streamprinter-printtext.swift
./validation-test/compiler_crashers_fixed/26967-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/28015-swift-constraints-constraintgraph-computeconnectedcomponents.swift
./validation-test/compiler_crashers_fixed/27736-void.swift
./validation-test/compiler_crashers_fixed/02076-swift-modulefile-getdecl.swift
./validation-test/compiler_crashers_fixed/00119-swift-dependentmembertype-get.swift
./validation-test/compiler_crashers_fixed/25644-swift-parser-parsedecl.swift
./validation-test/compiler_crashers_fixed/28830-formextensioninterfacetype-swift-type-swift-genericparamlist.swift
./validation-test/compiler_crashers_fixed/25561-swift-diagnosticengine-flushactivediagnostic.swift
./validation-test/compiler_crashers_fixed/01128-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/28812-getgenericparams.swift
./validation-test/compiler_crashers_fixed/27664-swift-nominaltypedecl-prepareextensions.swift
./validation-test/compiler_crashers_fixed/27277-swift-stmt-walk.swift
./validation-test/compiler_crashers_fixed/00299-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/00663-swift-module-lookupconformance.swift
./validation-test/compiler_crashers_fixed/25465-swift-namelookup-lookupinmodule.swift
./validation-test/compiler_crashers_fixed/26585-swift-modulefile-gettype.swift
./validation-test/compiler_crashers_fixed/27545-swift-nominaltypedecl-classifyasoptionaltype.swift
./validation-test/compiler_crashers_fixed/00595-swift-scopeinfo-addtoscope.swift
./validation-test/compiler_crashers_fixed/01396-swift-availabilityattr-isunavailable.swift
./validation-test/compiler_crashers_fixed/00424-no-stacktrace.random.swift
./validation-test/compiler_crashers_fixed/27882-swift-clangmoduleunit-lookupvalue.swift
./validation-test/compiler_crashers_fixed/01759-bool.swift
./validation-test/compiler_crashers_fixed/25408-swift-boundgenerictype-get.swift
./validation-test/compiler_crashers_fixed/28300-swift-type-transform.swift
./validation-test/compiler_crashers_fixed/27945-swift-conformancelookuptable-resolveconformances.swift
./validation-test/compiler_crashers_fixed/01787-swift-clangmoduleunit-getimportedmodules.swift
./validation-test/compiler_crashers_fixed/00727-swift-clangmoduleunit-getadaptermodule.swift
./validation-test/compiler_crashers_fixed/25675-swift-typechecker-resolvesuperclass.swift
./validation-test/compiler_crashers_fixed/01900-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/27931-swift-constraints-constraintsystem-salvage.swift
./validation-test/compiler_crashers_fixed/26687-bool.swift
./validation-test/compiler_crashers_fixed/26020-swift-parser-skipsingle.swift
./validation-test/compiler_crashers_fixed/28382-swift-archetypebuilder-maptypeoutofcontext.swift
./validation-test/compiler_crashers_fixed/26564-swift-parser-parsedecl.swift
./validation-test/compiler_crashers_fixed/00494-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/26758-swift-genericparamlist-deriveallarchetypes.swift
./validation-test/compiler_crashers_fixed/24797-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/01237-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/00186-swift-genericsignature-profile.swift
./validation-test/compiler_crashers_fixed/25738-swift-conformancelookuptable-updatelookuptable.swift
./validation-test/compiler_crashers_fixed/27810-swift-sourcefile-getcache.swift
./validation-test/compiler_crashers_fixed/02089-swift-typechecker-resolvetypeincontext.swift
./validation-test/compiler_crashers_fixed/01083-swift-typechecker-typecheckexpression.swift
./validation-test/compiler_crashers_fixed/01273-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/27682-swift-removeshadoweddecls.swift
./validation-test/compiler_crashers_fixed/02092-swift-abstractstoragedecl-makecomputed.swift
./validation-test/compiler_crashers_fixed/27387-swift-structtype-get.swift
./validation-test/compiler_crashers_fixed/26853-std-function-func-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/25514-bool.swift
./validation-test/compiler_crashers_fixed/27636-swift-typechecker-resolvetypeincontext.swift
./validation-test/compiler_crashers_fixed/28267-swift-typechecker-checkconformance.swift
./validation-test/compiler_crashers_fixed/26871-swift-typechecker-computeaccessibility.swift
./validation-test/compiler_crashers_fixed/27917-swift-printdecldescription.swift
./validation-test/compiler_crashers_fixed/00705-swift-typechecker-validategenericfuncsignature.swift
./validation-test/compiler_crashers_fixed/01829-llvm-foldingset-swift-classtype-nodeequals.swift
./validation-test/compiler_crashers_fixed/25847-emitsimpleassignment.swift
./validation-test/compiler_crashers_fixed/27198-swift-substitutedtype-get.swift
./validation-test/compiler_crashers_fixed/28799-swift-type-subst-swift-substitutionmap-const-swift-substoptions-const.swift
./validation-test/compiler_crashers_fixed/00370-swift-completegenerictyperesolver-resolvedependentmembertype.swift
./validation-test/compiler_crashers_fixed/01472-swift-modulefile-configurestorage.swift
./validation-test/compiler_crashers_fixed/25957-swift-parser-diagnose.swift
./validation-test/compiler_crashers_fixed/00125-swift-genericparamlist-addnestedarchetypes.swift
./validation-test/compiler_crashers_fixed/27861-swift-tuplepattern-createsimple.swift
./validation-test/compiler_crashers_fixed/26995-swift-typebase-isequal.swift
./validation-test/compiler_crashers_fixed/01206-swift-parser-parseexpridentifier.swift
./validation-test/compiler_crashers_fixed/27362-swift-stmt-walk.swift
./validation-test/compiler_crashers_fixed/25855-swift-lexer-kindofidentifier.swift
./validation-test/compiler_crashers_fixed/25841-swift-astcontext-getloadedmodule.swift
./validation-test/compiler_crashers_fixed/01863-swift-modulefile-maybereadpattern.swift
./validation-test/compiler_crashers_fixed/28642-swift-optionaltype-get-swift-type.swift
./validation-test/compiler_crashers_fixed/26134-swift-constraints-constraintsystem-solverstate-solverstate.swift
./validation-test/compiler_crashers_fixed/27704-swift-modulefile-declcommenttableinfo-readdata.swift
./validation-test/compiler_crashers_fixed/26955-swift-boundgenerictype-get.swift
./validation-test/compiler_crashers_fixed/01579-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/26929-swift-modulefile-maybereadpattern.swift
./validation-test/compiler_crashers_fixed/28460-child-source-range-not-contained-within-its-parent-guard-stmt.swift
./validation-test/compiler_crashers_fixed/28594-anonymous-namespace-verifier-verifychecked-swift-vardecl.swift
./validation-test/compiler_crashers_fixed/25532-swift-declname-printpretty.swift
./validation-test/compiler_crashers_fixed/28260-swift-constraints-constraintgraphnode-getmembertype.swift
./validation-test/compiler_crashers_fixed/01609-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/26920-swift-typebase-getanyoptionalobjecttype.swift
./validation-test/compiler_crashers_fixed/00818-c.swift
./validation-test/compiler_crashers_fixed/26006-swift-typechecker-checkdeclarationavailability.swift
./validation-test/compiler_crashers_fixed/25341-swift-inflightdiagnostic-fixitreplacechars.swift
./validation-test/compiler_crashers_fixed/00956-swift-type-print.swift
./validation-test/compiler_crashers_fixed/26185-swift-constraints-constraintsystem-matchtypes.swift
./validation-test/compiler_crashers_fixed/25950-swift-markasobjc.swift
./validation-test/compiler_crashers_fixed/26190-swift-iterabledeclcontext-getmembers.swift
./validation-test/compiler_crashers_fixed/24769-std-function-func-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/25447-llvm-tinyptrvector-swift-valuedecl-push-back.swift
./validation-test/compiler_crashers_fixed/28468-segfault-0xd09050-0xd08dfd-0xbe9d76-0xbeb154.swift
./validation-test/compiler_crashers_fixed/25345-swift-parser-parsedecl.swift
./validation-test/compiler_crashers_fixed/25361-swift-funcdecl-setdeserializedsignature.swift
./validation-test/compiler_crashers_fixed/23974-swift-declname-printpretty.swift
./validation-test/compiler_crashers_fixed/27778-swift-astcontext-getbridgedtoobjc.swift
./validation-test/compiler_crashers_fixed/27181-swift-patternbindingdecl-setpattern.swift
./validation-test/compiler_crashers_fixed/01555-swift-constraints-constraintsystem-simplifytype.swift
./validation-test/compiler_crashers_fixed/01918-swift-clangmoduleunit-getimportedmodules.swift
./validation-test/compiler_crashers_fixed/28145-swift-constraints-constraintsystem-getconstraintlocator.swift
./validation-test/compiler_crashers_fixed/26383-swift-typebase-isspecialized.swift
./validation-test/compiler_crashers_fixed/28650-unreachable-executed-at-swift-lib-sema-typecheckstmt-cpp-1031.swift
./validation-test/compiler_crashers_fixed/25716-swift-modulefile-getdecl.swift
./validation-test/compiler_crashers_fixed/01976-llvm-yaml-scalartraits-float-input.swift
./validation-test/compiler_crashers_fixed/00971-swift-parser-parsebraceitems.swift
./validation-test/compiler_crashers_fixed/27672-swift-dependentmembertype-get.swift
./validation-test/compiler_crashers_fixed/25817-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/28013-std-function-func-swift-archetypebuilder-visitinherited.swift
./validation-test/compiler_crashers_fixed/26278-swift-conformancelookuptable-updatelookuptable.swift
./validation-test/compiler_crashers_fixed/26106-swift-typebase-getsuperclass.swift
./validation-test/compiler_crashers_fixed/00478-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/26903-swift-constraints-constraintgraph-addconstraint.swift
./validation-test/compiler_crashers_fixed/26788-swift-typebase-getsuperclass.swift
./validation-test/compiler_crashers_fixed/27765-swift-typechecker-typecheckpatternbinding.swift
./validation-test/compiler_crashers_fixed/00748-getmemberforbasetype.swift
./validation-test/compiler_crashers_fixed/01974-swift-declname-declname.swift
./validation-test/compiler_crashers_fixed/27705-swift-lexer-getlocforendoftoken.swift
./validation-test/compiler_crashers_fixed/00273-swift-constraints-constraintgraphnode-getadjacency.swift
./validation-test/compiler_crashers_fixed/26434-swift-typeloc-iserror.swift
./validation-test/compiler_crashers_fixed/01415-swift-typebase-getanyoptionalobjecttype.swift
./validation-test/compiler_crashers_fixed/02123-swift-clangmoduleunit-getadaptermodule.swift
./validation-test/compiler_crashers_fixed/27554-swift-modulefile-gettype.swift
./validation-test/compiler_crashers_fixed/28714-result-case-not-implemented.swift
./validation-test/compiler_crashers_fixed/00639-void.swift
./validation-test/compiler_crashers_fixed/27100-swift-genericsignature-getcanonical.swift
./validation-test/compiler_crashers_fixed/26486-swift-modulefile-maybereadpattern.swift
./validation-test/compiler_crashers_fixed/27942-resolveidenttypecomponent.swift
./validation-test/compiler_crashers_fixed/25551-llvm-bitstreamcursor-read.swift
./validation-test/compiler_crashers_fixed/26781-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/27461-swift-genericparamlist-addnestedarchetypes.swift
./validation-test/compiler_crashers_fixed/00898-swift-diagnosticengine-flushactivediagnostic.swift
./validation-test/compiler_crashers_fixed/00058-get-self-type-for-container.swift
./validation-test/compiler_crashers_fixed/28548-cantype-hastypeparameter-already-have-an-interface-type.swift
./validation-test/compiler_crashers_fixed/25640-swift-modulefile-declcommenttableinfo-readdata.swift
./validation-test/compiler_crashers_fixed/28345-swift-iterativetypechecker-processtypechecksuperclass.swift
./validation-test/compiler_crashers_fixed/01910-swift-modulefile-gettype.swift
./validation-test/compiler_crashers_fixed/01116-swift-typechecker-coercepatterntotype.swift
./validation-test/compiler_crashers_fixed/01975-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/28832-superclass-superclass-hasarchetype-superclass-must-be-interface-type.swift
./validation-test/compiler_crashers_fixed/26670-swift-modulefile-gettype.swift
./validation-test/compiler_crashers_fixed/27183-swift-diagnosticengine-flushactivediagnostic.swift
./validation-test/compiler_crashers_fixed/27231-std-function-func-swift-constraints-constraintsystem-simplifytype.swift
./validation-test/compiler_crashers_fixed/02140-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/26293-swift-conformancelookuptable-getconformance.swift
./validation-test/compiler_crashers_fixed/01172-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/26340-swift-lexer-getlocforendoftoken.swift
./validation-test/compiler_crashers_fixed/27272-swift-constraints-constraintgraph-addconstraint.swift
./validation-test/compiler_crashers_fixed/27491-swift-modulefile-maybereadgenericparams.swift
./validation-test/compiler_crashers_fixed/27104-swift-modulefile-lookupvalue.swift
./validation-test/compiler_crashers_fixed/01841-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/25929-swift-typechecker-validatetype.swift
./validation-test/compiler_crashers_fixed/03204-swift-type-transform.swift
./validation-test/compiler_crashers_fixed/25385-swift-patternbindingdecl-setpattern.swift
./validation-test/compiler_crashers_fixed/27279-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/01852-swift-constraints-constraintsystem-getconstraintlocator.swift
./validation-test/compiler_crashers_fixed/25573-swift-typechecker-lookupmember.swift
./validation-test/compiler_crashers_fixed/27691-void.swift
./validation-test/compiler_crashers_fixed/00195-swift-namelookup-lookupinmodule.swift
./validation-test/compiler_crashers_fixed/02158-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/00944-std-function-func-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/27456-swift-abstractclosureexpr-setparams.swift
./validation-test/compiler_crashers_fixed/27798-swift-typechecker-overapproximateosversionsatlocation.swift
./validation-test/compiler_crashers_fixed/02058-swift-constraints-constraintsystem-solvesimplified.swift
./validation-test/compiler_crashers_fixed/25348-swift-markasobjc.swift
./validation-test/compiler_crashers_fixed/00574-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/26241-swift-genericsignature-genericsignature.swift
./validation-test/compiler_crashers_fixed/28187-llvm-foldingset-swift-constraints-constraintlocator.swift
./validation-test/compiler_crashers_fixed/28155-swift-typechecker-validategenericfuncsignature.swift
./validation-test/compiler_crashers_fixed/00631-swift-constraints-constraintsystem-getfixedtyperecursive.swift
./validation-test/compiler_crashers_fixed/25538-swift-archetypebuilder-finalize.swift
./validation-test/compiler_crashers_fixed/25729-void.swift
./validation-test/compiler_crashers_fixed/25397-swift-astcontext-allocate.swift
./validation-test/compiler_crashers_fixed/27307-swift-modulefile-gettype.swift
./validation-test/compiler_crashers_fixed/00648-swift-declcontext-lookupqualified.swift
./validation-test/compiler_crashers_fixed/00927-swift-constraints-solution-computesubstitutions.swift
./validation-test/compiler_crashers_fixed/26590-swift-genericparamlist-deriveallarchetypes.swift
./validation-test/compiler_crashers_fixed/02073-swift-optional-swift-diagnostic-operator.swift
./validation-test/compiler_crashers_fixed/28814-basety-hasunboundgenerictype.swift
./validation-test/compiler_crashers_fixed/01763-swift-archetypebuilder-resolvearchetype.swift
./validation-test/compiler_crashers_fixed/25645-llvm-bitstreamcursor-read.swift
./validation-test/compiler_crashers_fixed/28401-swift-boundgenerictype-get.swift
./validation-test/compiler_crashers_fixed/00965-swift-availabilityattr-isunavailable.swift
./validation-test/compiler_crashers_fixed/26142-llvm-raw-ostream-setbuffered.swift
./validation-test/compiler_crashers_fixed/25480-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/28856-typevariables-impl-getgraphindex-typevar-type-variable-mismatch.swift
./validation-test/compiler_crashers_fixed/26768-std-function-func-mapsignaturetype.swift
./validation-test/compiler_crashers_fixed/27022-swift-classtype-get.swift
./validation-test/compiler_crashers_fixed/00826-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/02049-swift-pattern-foreachvariable.swift
./validation-test/compiler_crashers_fixed/01906-llvm-foldingset-swift-tupletype-nodeequals.swift
./validation-test/compiler_crashers_fixed/25849-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/28575-unreachable-executed-at-swift-lib-sema-csapply-cpp-5647.swift
./validation-test/compiler_crashers_fixed/00088-swift-archetypetype-getnestedtype.swift
./validation-test/compiler_crashers_fixed/00153-swift-parser-parsetypesimple.swift
./validation-test/compiler_crashers_fixed/26620-swift-tupletype-get.swift
./validation-test/compiler_crashers_fixed/25819-std-function-func-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/01859-swift-constraints-solution-solution.swift
./validation-test/compiler_crashers_fixed/26718-swift-parser-parsedeclvar.swift
./validation-test/compiler_crashers_fixed/25659-swift-modulefile-gettype.swift
./validation-test/compiler_crashers_fixed/02120-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/00306-std-function-func-mapsignaturetype.swift
./validation-test/compiler_crashers_fixed/01803-swift-modulefile-getdecl.swift
./validation-test/compiler_crashers_fixed/00318-swift-diagnosticengine-flushactivediagnostic.swift
./validation-test/compiler_crashers_fixed/26039-swift-valuedecl-settype.swift
./validation-test/compiler_crashers_fixed/00056-addminimumprotocols.swift
./validation-test/compiler_crashers_fixed/25506-swift-type-print.swift
./validation-test/compiler_crashers_fixed/26362-swift-archetypetype-getnew.swift
./validation-test/compiler_crashers_fixed/00905-swift-typechecker-checksubstitutions.swift
./validation-test/compiler_crashers_fixed/27803-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/28237-swift-archetypebuilder-addgenericparameter.swift
./validation-test/compiler_crashers_fixed/28400-swift-nominaltypedecl-prepareextensions.swift
./validation-test/compiler_crashers_fixed/26543-swift-parser-parsedecl.swift
./validation-test/compiler_crashers_fixed/01224-swift-parser-skipsingle.swift
./validation-test/compiler_crashers_fixed/28144-swift-typechecker-substituteinputsugartypeforresult.swift
./validation-test/compiler_crashers_fixed/27105-swift-typebase-gettypevariables.swift
./validation-test/compiler_crashers_fixed/26313-llvm-densemapbase-llvm-densemap-swift-silbasicblock.swift
./validation-test/compiler_crashers_fixed/27168-swift-constraints-constraintsystem-matchtypes.swift
./validation-test/compiler_crashers_fixed/28388-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/28536-swift-namelookup-lookupinmodule-swift-moduledecl-llvm-arrayref-std-pair-swift-id.swift
./validation-test/compiler_crashers_fixed/28815-formprotocolrelativetype-swift-protocoldecl-swift-genericsignaturebuilder-potent.swift
./validation-test/compiler_crashers_fixed/25452-swift-typechecker-typecheckpattern.swift
./validation-test/compiler_crashers_fixed/01758-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/28233-swift-typebase-getmembersubstitutions.swift
./validation-test/compiler_crashers_fixed/27744-swift-astprinter-printtextimpl.swift
./validation-test/compiler_crashers_fixed/25343-swift-parser-parsedeclfunc.swift
./validation-test/compiler_crashers_fixed/00795-swift-type-transform.swift
./validation-test/compiler_crashers_fixed/00952-swift-constraints-constraintgraph-gatherconstraints.swift
./validation-test/compiler_crashers_fixed/25352-swift-boundgenerictype-getsubstitutions.swift
./validation-test/compiler_crashers_fixed/00583-swift-funcdecl-setdeserializedsignature.swift
./validation-test/compiler_crashers_fixed/01780-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/25497-llvm-foldingset-swift-constraints-constraintlocator-nodeequals.swift
./validation-test/compiler_crashers_fixed/27646-swift-markasobjc.swift
./validation-test/compiler_crashers_fixed/01267-swift-protocoltype-canonicalizeprotocols.swift
./validation-test/compiler_crashers_fixed/01546-vtable.swift
./validation-test/compiler_crashers_fixed/01564-swift-constraints-constraintsystem-getfixedtyperecursive.swift
./validation-test/compiler_crashers_fixed/26440-swift-constraints-constraintsystem-salvage.swift
./validation-test/compiler_crashers_fixed/28659-isactuallycanonicalornull-forming-a-cantype-out-of-a-non-canonical-type.swift
./validation-test/compiler_crashers_fixed/26215-swift-parser-consumeidentifier.swift
./validation-test/compiler_crashers_fixed/26372-void.swift
./validation-test/compiler_crashers_fixed/28623-swift-tupletype-get-llvm-arrayref-swift-tupletypeelt-swift-astcontext-const.swift
./validation-test/compiler_crashers_fixed/00418-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/00262-swift-camel-case-getfirstword.swift
./validation-test/compiler_crashers_fixed/28425-swift-constraints-solution-convertbooleantypetobuiltini.swift
./validation-test/compiler_crashers_fixed/01797-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/28515-getmutableaddressor.swift
./validation-test/compiler_crashers_fixed/27218-swift-vardecl-getparentpattern.swift
./validation-test/compiler_crashers_fixed/26180-llvm-foldingset-swift-tupletype-nodeequals.swift
./validation-test/compiler_crashers_fixed/26886-swift-stmt-walk.swift
./validation-test/compiler_crashers_fixed/01978-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/28737-genericenv-nullptr-too-much-circularity.swift
./validation-test/compiler_crashers_fixed/27385-swift-modulefile-getdecl.swift
./validation-test/compiler_crashers_fixed/26882-swift-typechecker-definedefaultconstructor.swift
./validation-test/compiler_crashers_fixed/01027-llvm-foldingset-swift-genericsignature-nodeequals.swift
./validation-test/compiler_crashers_fixed/27845-swift-typebase-isequal.swift
./validation-test/compiler_crashers_fixed/27090-swift-conformancelookuptable-expandimpliedconformances.swift
./validation-test/compiler_crashers_fixed/27709-swift-removeshadoweddecls.swift
./validation-test/compiler_crashers_fixed/00866-swift-constraints-constraintgraph-addconstraint.swift
./validation-test/compiler_crashers_fixed/27713-swift-constraints-constraintgraph-gatherconstraints.swift
./validation-test/compiler_crashers_fixed/28315-swift-declcontext-iscascadingcontextforlookup.swift
./validation-test/compiler_crashers_fixed/26200-llvm-bitstreamcursor-read.swift
./validation-test/compiler_crashers_fixed/25982-swift-parser-skipsingle.swift
./validation-test/compiler_crashers_fixed/25977-swift-parser-parseexprcallsuffix.swift
./validation-test/compiler_crashers_fixed/00110-swift-constraints-constraintsystem-matchtypes.swift
./validation-test/compiler_crashers_fixed/00229-getarchetypesubstitution.random.swift
./validation-test/compiler_crashers_fixed/26657-swift-tupletype-get.swift
./validation-test/compiler_crashers_fixed/25423-swift-inouttype-get.swift
./validation-test/compiler_crashers_fixed/01442-swift-genericfunctiontype-get.swift
./validation-test/compiler_crashers_fixed/27226-swift-lexer-leximpl.swift
./validation-test/compiler_crashers_fixed/27669-swift-parser-skipsingle.swift
./validation-test/compiler_crashers_fixed/28853-result-second.swift
./validation-test/compiler_crashers_fixed/27176-swift-streamprinter-printtext.swift
./validation-test/compiler_crashers_fixed/27552-swift-constraints-constraintsystem-solverstate-solverstate.swift
./validation-test/compiler_crashers_fixed/28027-swift-typebase-getmembersubstitutions.swift
./validation-test/compiler_crashers_fixed/27643-swift-valuedecl-settype.swift
./validation-test/compiler_crashers_fixed/27479-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/26874-swift-nominaltypedecl-getmembers.swift
./validation-test/compiler_crashers_fixed/01378-swift-typechecker-typecheckpattern.swift
./validation-test/compiler_crashers_fixed/25997-swift-parser-parsedeclstruct.swift
./validation-test/compiler_crashers_fixed/27442-swift-parser-parseexprclosure.swift
./validation-test/compiler_crashers_fixed/26646-swift-constraints-constraintgraphnode-addconstraint.swift
./validation-test/compiler_crashers_fixed/02134-swift-constraints-constraintsystem-matchtypes.swift
./validation-test/compiler_crashers_fixed/27453-diagnoseredundantaccessors.swift
./validation-test/compiler_crashers_fixed/25375-swift-typebase-isequal.swift
./validation-test/compiler_crashers_fixed/27551-swift-protocoldecl-existentialtypesupportedslow.swift
./validation-test/compiler_crashers_fixed/01898-swift-parser-parsefunctionarguments.swift
./validation-test/compiler_crashers_fixed/27000-swift-typebase-gettypevariables.swift
./validation-test/compiler_crashers_fixed/01580-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/00779-swift-parser-parsetoken.swift
./validation-test/compiler_crashers_fixed/28688-unreachable-executed-at-swift-lib-ast-type-cpp-1349.swift
./validation-test/compiler_crashers_fixed/27665-swift-conformancelookuptable-getallprotocols.swift
./validation-test/compiler_crashers_fixed/27081-swift-protocoltype-canonicalizeprotocols.swift
./validation-test/compiler_crashers_fixed/00172-swift-archetypebuilder-inferrequirementswalker-walktotypepost.swift
./validation-test/compiler_crashers_fixed/26745-swift-typechecker-addimplicitconstructors.swift
./validation-test/compiler_crashers_fixed/28003-swift-constraints-constraintsystem-recordfix.swift
./validation-test/compiler_crashers_fixed/28431-swift-lexer-lexoperatoridentifier.swift
./validation-test/compiler_crashers_fixed/27982-swift-constraints-constraintsystem-diagnosefailureforexpr.swift
./validation-test/compiler_crashers_fixed/28558-known-typewitnesses-end-didnt-resolve-witness.swift
./validation-test/compiler_crashers_fixed/27679-swift-constraints-constraintsystem-solverstate-solverstate.swift
./validation-test/compiler_crashers_fixed/27726-swift-modulefile-declcommenttableinfo-readdata.swift
./validation-test/compiler_crashers_fixed/27717-swift-constraints-constraintsystem-matchtypes.swift
./validation-test/compiler_crashers_fixed/00395-swift-constraints-constraintsystem-getfixedtyperecursive.swift
./validation-test/compiler_crashers_fixed/01987-swift-functiontype-get.swift
./validation-test/compiler_crashers_fixed/01119-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/00151-swift-parser-parsetype.swift
./validation-test/compiler_crashers_fixed/01706-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/01077-swift-declcontext-lookupqualified.swift
./validation-test/compiler_crashers_fixed/01112-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/27583-swift-functiontype-get.swift
./validation-test/compiler_crashers_fixed/25484-swift-modulefile-getdecl.swift
./validation-test/compiler_crashers_fixed/25526-swift-lexer-lexidentifier.swift
./validation-test/compiler_crashers_fixed/25518-swift-lexer-leximpl.swift
./validation-test/compiler_crashers_fixed/26510-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/25615-swift-typechecker-coercepatterntotype.swift
./validation-test/compiler_crashers_fixed/01492-swift-constraints-constraintsystem-matchtypes.swift
./validation-test/compiler_crashers_fixed/26845-swift-substitutedtype-get.swift
./validation-test/compiler_crashers_fixed/00343-connectedcomponentsdfs.swift
./validation-test/compiler_crashers_fixed/26598-swift-modulefile-getdecl.swift
./validation-test/compiler_crashers_fixed/01784-swift-constraints-constraintgraph-lookupnode.swift
./validation-test/compiler_crashers_fixed/27909-llvm-densemapbase-llvm-densemap-swift-identifier.swift
./validation-test/compiler_crashers_fixed/25490-swift-streamprinter-printtext.swift
./validation-test/compiler_crashers_fixed/00488-swift-clangmoduleunit-getadaptermodule.swift
./validation-test/compiler_crashers_fixed/27563-swift-funcdecl-isunaryoperator.swift
./validation-test/compiler_crashers_fixed/28716-unreachable-executed-at-swift-lib-ast-type-cpp-1215.swift
./validation-test/compiler_crashers_fixed/01013-swift-module-lookupconformance.swift
./validation-test/compiler_crashers_fixed/00923-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/25373-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/00179-swift-protocolcompositiontype-build.swift
./validation-test/compiler_crashers_fixed/27550-swift-moduledecl-lookupconformance.swift
./validation-test/compiler_crashers_fixed/25822-swift-typechecker-coercepatterntotype.swift
./validation-test/compiler_crashers_fixed/01129-swift-functiontype-get.swift
./validation-test/compiler_crashers_fixed/28331-swift-createdesignatedinitoverride.swift
./validation-test/compiler_crashers_fixed/26654-swift-markasobjc.swift
./validation-test/compiler_crashers_fixed/01947-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/28282-swift-constraints-solution-coercetotype.swift
./validation-test/compiler_crashers_fixed/25694-llvm-foldingset-swift-classtype-nodeequals.swift
./validation-test/compiler_crashers_fixed/01809-llvm-foldingset-swift-boundgenerictype-nodeequals.swift
./validation-test/compiler_crashers_fixed/26181-swift-modulefile-getdecl.swift
./validation-test/compiler_crashers_fixed/26515-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/27707-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/00480-szone-free-definite-size.swift
./validation-test/compiler_crashers_fixed/28288-swift-genericparamlist-getsubstitutionmap.swift
./validation-test/compiler_crashers_fixed/00811-swift-modulefile-getdecl.swift
./validation-test/compiler_crashers_fixed/25633-llvm-smdiagnostic-print.swift
./validation-test/compiler_crashers_fixed/02084-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/26087-swift-typebase-getanyoptionalobjecttype.swift
./validation-test/compiler_crashers_fixed/00154-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/01980-swift-typebase-operator.swift
./validation-test/compiler_crashers_fixed/25548-void.swift
./validation-test/compiler_crashers_fixed/27537-swift-clangimporter-implementation-finishpendingactions.swift
./validation-test/compiler_crashers_fixed/25656-swift-parser-applyattributetotype.swift
./validation-test/compiler_crashers_fixed/00751-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/01017-llvm-foldingset-swift-constraints-constraintlocator-nodeequals.swift
./validation-test/compiler_crashers_fixed/27423-swift-constraints-constraintsystem-finalize.swift
./validation-test/compiler_crashers_fixed/25590-swift-declcontext-getlocalconformances.swift
./validation-test/compiler_crashers_fixed/28026-swift-protocolcompositiontype-build.swift
./validation-test/compiler_crashers_fixed/25999-swift-nominaltype-get.swift
./validation-test/compiler_crashers_fixed/27915-swift-typechecker-checkomitneedlesswords.swift
./validation-test/compiler_crashers_fixed/27019-swift-genericfunctiontype-get.swift
./validation-test/compiler_crashers_fixed/01692-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/00687-swift-modulefile-getdecl.swift
./validation-test/compiler_crashers_fixed/01543-bool.swift
./validation-test/compiler_crashers_fixed/02162-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/00999-swift-parser-skipsingle.swift
./validation-test/compiler_crashers_fixed/27779-swift-abstractstoragedecl-getobjcgetterselector.swift
./validation-test/compiler_crashers_fixed/27620-swift-genericsignature-genericsignature.swift
./validation-test/compiler_crashers_fixed/27542-swift-genericfunctiontype-get.swift
./validation-test/compiler_crashers_fixed/26161-swift-patternbindingdecl-setpattern.swift
./validation-test/compiler_crashers_fixed/28239-swift-declcontext-lookupqualified.swift
./validation-test/compiler_crashers_fixed/00344-substituteinputsugarargumenttype.swift
./validation-test/compiler_crashers_fixed/26114-swift-iterabledeclcontext-getmembers.swift
./validation-test/compiler_crashers_fixed/00389-swift-diagnosticengine-flushactivediagnostic.swift
./validation-test/compiler_crashers_fixed/00560-swift-declcontext-lookupqualified.swift
./validation-test/compiler_crashers_fixed/00519-void.swift
./validation-test/compiler_crashers_fixed/00515-bool.swift
./validation-test/compiler_crashers_fixed/26207-swift-astcontext-allocate.swift
./validation-test/compiler_crashers_fixed/27083-swift-typechecker-coercepatterntotype.swift
./validation-test/compiler_crashers_fixed/28052-swift-moduledecl-lookupvalue.swift
./validation-test/compiler_crashers_fixed/26994-swift-nominaltypedecl-prepareextensions.swift
./validation-test/compiler_crashers_fixed/28224-swift-genericfunctiontype-get.swift
./validation-test/compiler_crashers_fixed/01568-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/26535-swift-typebase-getimplicitlyunwrappedoptionalobjecttype.swift
./validation-test/compiler_crashers_fixed/01319-swift-typechecker-checksubstitutions.swift
./validation-test/compiler_crashers_fixed/28450-underlyingty-gettype-isnull-getting-invalid-underlying-type-failed.swift
./validation-test/compiler_crashers_fixed/25650-checktypedeclavailability.swift
./validation-test/compiler_crashers_fixed/01310-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/28750-false-should-have-found-context-by-now.swift
./validation-test/compiler_crashers_fixed/27868-swift-typechecker-getdefaulttype.swift
./validation-test/compiler_crashers_fixed/00922-swift-lexer-getlocforendoftoken.swift
./validation-test/compiler_crashers_fixed/26480-swift-typebase-getsuperclass.swift
./validation-test/compiler_crashers_fixed/25503-swift-namelookup-lookupinmodule.swift
./validation-test/compiler_crashers_fixed/27150-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/01984-swift-protocoltype-canonicalizeprotocols.swift
./validation-test/compiler_crashers_fixed/25627-swift-archetypebuilder-addconformancerequirement.swift
./validation-test/compiler_crashers_fixed/01717-getcallerdefaultarg.swift
./validation-test/compiler_crashers_fixed/01708-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/28535-unreachable-executed-at-swift-lib-parse-parsedecl-cpp-610.swift
./validation-test/compiler_crashers_fixed/00456-llvm-ondiskchainedhashtable-swift-modulefile-decltableinfo-find.swift
./validation-test/compiler_crashers_fixed/28129-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/01063-swift-clangmoduleunit-getadaptermodule.swift
./validation-test/compiler_crashers_fixed/28176-swift-parser-parsegenericparameters.swift
./validation-test/compiler_crashers_fixed/27188-swift-diagnosticengine-emitdiagnostic.swift
./validation-test/compiler_crashers_fixed/00161-swift-tupletype-get.swift
./validation-test/compiler_crashers_fixed/27197-std-function-func-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/27444-swift-typebase-getanyoptionalobjecttype.swift
./validation-test/compiler_crashers_fixed/00315-swift-genericsignature-get.swift
./validation-test/compiler_crashers_fixed/28262-swift-typechecker-applyunboundgenericarguments.swift
./validation-test/compiler_crashers_fixed/00506-swift-boundgenerictype-get.swift
./validation-test/compiler_crashers_fixed/01002-swift-parentype-get.swift
./validation-test/compiler_crashers_fixed/25792-swift-constraints-constraintgraphscope-constraintgraphscope.swift
./validation-test/compiler_crashers_fixed/01242-llvm-smallvectorimpl-swift-diagnosticargument-operator.swift
./validation-test/compiler_crashers_fixed/27141-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/27467-vtable.swift
./validation-test/compiler_crashers_fixed/26279-swift-constraints-constraintsystem-simplifytype.swift
./validation-test/compiler_crashers_fixed/27575-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/28284-swift-cantype-isreferencetypeimpl.swift
./validation-test/compiler_crashers_fixed/27238-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/25657-llvm-bitstreamcursor-read.swift
./validation-test/compiler_crashers_fixed/27457-llvm-tinyptrvector-swift-valuedecl-push-back.swift
./validation-test/compiler_crashers_fixed/27344-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/25710-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/01355-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/26775-swift-lexer-kindofidentifier.swift
./validation-test/compiler_crashers_fixed/26028-swift-parser-skipsingle.swift
./validation-test/compiler_crashers_fixed/27507-swift-modulefile-lookupvalue.swift
./validation-test/compiler_crashers_fixed/28574-iscomplete-isinvalid-resolver-did-not-resolve-requirement.swift
./validation-test/compiler_crashers_fixed/27984-llvm-densemapbase-llvm-densemap-swift-declname.swift
./validation-test/compiler_crashers_fixed/26404-swift-parser-parsedecl.swift
./validation-test/compiler_crashers_fixed/25661-swift-parser-parsestmtif.swift
./validation-test/compiler_crashers_fixed/25749-swift-astcontext-allocate.swift
./validation-test/compiler_crashers_fixed/01005-swift-nominaltype-get.swift
./validation-test/compiler_crashers_fixed/26549-swift-typechecker-resolvetypeincontext.swift
./validation-test/compiler_crashers_fixed/01552-swift-constraints-solution-solution.swift
./validation-test/compiler_crashers_fixed/00145-swift-parser-parsebraceitems.swift
./validation-test/compiler_crashers_fixed/01643-swift-typechecker-checksubstitutions.swift
./validation-test/compiler_crashers_fixed/25421-swift-conformancelookuptable-getimplicitprotocols.swift
./validation-test/compiler_crashers_fixed/27877-swift-constructordecl-setbodyparams.swift
./validation-test/compiler_crashers_fixed/26209-swift-astcontext-getidentifier.swift
./validation-test/compiler_crashers_fixed/00176-vtable.swift
./validation-test/compiler_crashers_fixed/26769-swift-tuplepattern-createsimple.swift
./validation-test/compiler_crashers_fixed/25966-llvm-densemap-swift-normalprotocolconformance.swift
./validation-test/compiler_crashers_fixed/25426-swift-parser-parsedecl.swift
./validation-test/compiler_crashers_fixed/00532-swift-constraints-solution-solution.swift
./validation-test/compiler_crashers_fixed/01323-swift-completegenerictyperesolver-resolvedependentmembertype.swift
./validation-test/compiler_crashers_fixed/01324-swift-constraints-constraintgraph-removeconstraint.swift
./validation-test/compiler_crashers_fixed/00926-swift-constraints-constraintsystem-opengeneric.swift
./validation-test/compiler_crashers_fixed/28689-swift-lowering-silgenfunction-emitopenexistential.swift
./validation-test/compiler_crashers_fixed/02035-swift-constraints-constraintsystem-matchdeepequalitytypes.swift
./validation-test/compiler_crashers_fixed/26605-swift-parser-diagnose.swift
./validation-test/compiler_crashers_fixed/25742-swift-moduledecl-lookupvalue.swift
./validation-test/compiler_crashers_fixed/01429-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/28186-swift-silwitnessvisitor-visitprotocoldecl.swift
./validation-test/compiler_crashers_fixed/00323-swift-apply-generic-protocol.swift
./validation-test/compiler_crashers_fixed/26421-swift-generictypeparamtype-get.swift
./validation-test/compiler_crashers_fixed/26581-swift-typechecker-checkdeclarationavailability.swift
./validation-test/compiler_crashers_fixed/26042-swift-inflightdiagnostic-fixitreplacechars.swift
./validation-test/compiler_crashers_fixed/25374-swift-diagnosticengine-emitdiagnostic.swift
./validation-test/compiler_crashers_fixed/01220-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/28842-hasval.swift
./validation-test/compiler_crashers_fixed/27148-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/27365-swift-modulefile-getcommentfordecl.swift
./validation-test/compiler_crashers_fixed/01927-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/28721-unreachable-executed-at-swift-lib-ast-astmangler-cpp-451.swift
./validation-test/compiler_crashers_fixed/26329-swift-unqualifiedlookup-unqualifiedlookup.swift
./validation-test/compiler_crashers_fixed/01821-llvm-foldingset-swift-tupletype-nodeequals.swift
./validation-test/compiler_crashers_fixed/28559-result-case-not-implemented.swift
./validation-test/compiler_crashers_fixed/02038-llvm-bitstreamcursor-readvbr.swift
./validation-test/compiler_crashers_fixed/00233-swift-typechecker-validategenericfuncsignature.swift
./validation-test/compiler_crashers_fixed/00840-swift-constraints-solution-computesubstitutions.swift
./validation-test/compiler_crashers_fixed/00878-swift-constraints-constraintsystem-getfixedtyperecursive.swift
./validation-test/compiler_crashers_fixed/26839-swift-declcontext-lookupqualified.swift
./validation-test/compiler_crashers_fixed/25739-swift-typechecker-coercepatterntotype.swift
./validation-test/compiler_crashers_fixed/01256-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/00199-swift-optional-swift-diagnostic-operator.swift
./validation-test/compiler_crashers_fixed/25907-swift-parser-skipsingle.swift
./validation-test/compiler_crashers_fixed/01865-swift-typechecker-validatetype.swift
./validation-test/compiler_crashers_fixed/27907-swift-constraints-constraintsystem-solvesimplified.swift
./validation-test/compiler_crashers_fixed/28383-swift-constraints-constraintgraphnode-getmembertype.swift
./validation-test/compiler_crashers_fixed/28045-swift-typechecker-typecheckpatternbinding.swift
./validation-test/compiler_crashers_fixed/01340-llvm-getelementptrinst-getindexedtype.swift
./validation-test/compiler_crashers_fixed/00360-swift-parser-parseexprlist.swift
./validation-test/compiler_crashers_fixed/00815-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/26733-swift-diagnosticengine-emitdiagnostic.swift
./validation-test/compiler_crashers_fixed/01179-swift-declcontext-lookupqualified.swift
./validation-test/compiler_crashers_fixed/02045-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/01875-swift-modulefile-gettype.swift
./validation-test/compiler_crashers_fixed/01402-swift-typebase-getanyoptionalobjecttype.swift
./validation-test/compiler_crashers_fixed/27201-swift-diagnosticengine-emitdiagnostic.swift
./validation-test/compiler_crashers_fixed/27445-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/25469-swift-constraints-constraintsystem-matchtypes.swift
./validation-test/compiler_crashers_fixed/27390-swift-typechecker-computeaccessibility.swift
./validation-test/compiler_crashers_fixed/26559-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/01862-swift-genericparamlist-deriveallarchetypes.swift
./validation-test/compiler_crashers_fixed/28053-swift-parser-parsedeclvar.swift
./validation-test/compiler_crashers_fixed/26010-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/26567-llvm-foldingset-swift-boundgenerictype-nodeequals.swift
./validation-test/compiler_crashers_fixed/00615-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/26979-std-function-func-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/01549-llvm-foldingset-swift-declname-compounddeclname-nodeequals.swift
./validation-test/compiler_crashers_fixed/27888-swift-typechecker-resolveinheritanceclause.swift
./validation-test/compiler_crashers_fixed/27087-swift-declcontext-getlocalconformances.swift
./validation-test/compiler_crashers_fixed/01279-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/01603-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/00439-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/27933-swift-constraints-constraintsystem-simplifytype.swift
./validation-test/compiler_crashers_fixed/28069-swift-nominaltypedecl-classifyasoptionaltype.swift
./validation-test/compiler_crashers_fixed/28501-haderror-m-is-sourcefile-m-get-sourcefile-aststage-sourcefile-typechecked-overlo.swift
./validation-test/compiler_crashers_fixed/27906-swift-valuedecl.swift
./validation-test/compiler_crashers_fixed/25867-swift-valuedecl-getoverloadsignature.swift
./validation-test/compiler_crashers_fixed/28165-swift-archetypetype-getnestedtype.swift
./validation-test/compiler_crashers_fixed/01121-swift-derivedconformance-deriveequatable.swift
./validation-test/compiler_crashers_fixed/27014-swift-modulefile-loadextensions.swift
./validation-test/compiler_crashers_fixed/00429-vtable.swift
./validation-test/compiler_crashers_fixed/27895-swift-sourcefile-getcache.swift
./validation-test/compiler_crashers_fixed/25941-swift-modulefile-gettype.swift
./validation-test/compiler_crashers_fixed/28048-swift-astcontext-getspecializedconformance.swift
./validation-test/compiler_crashers_fixed/28583-unreachable-executed-at-swift-lib-ast-type-cpp-1098.swift
./validation-test/compiler_crashers_fixed/27624-swift-typebase-isequal.swift
./validation-test/compiler_crashers_fixed/27959-swift-conformancelookuptable-conformancelookuptable.swift
./validation-test/compiler_crashers_fixed/01423-swift-typechecker-checksubstitutions.swift
./validation-test/compiler_crashers_fixed/00253-swift-constraints-constraintsystem-constraintsystem.swift
./validation-test/compiler_crashers_fixed/27107-swift-typeloc-iserror.swift
./validation-test/compiler_crashers_fixed/00546-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/00710-swift-clangmoduleunit-getadaptermodule.swift
./validation-test/compiler_crashers_fixed/27065-swift-typechecker-typecheckclosurebody.swift
./validation-test/compiler_crashers_fixed/22250-swift-typevisitor.swift
./validation-test/compiler_crashers_fixed/25664-swift-typechecker-validatetype.swift
./validation-test/compiler_crashers_fixed/00657-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/27348-swift-constraints-constraintsystem-solve.swift
./validation-test/compiler_crashers_fixed/28028-swift-astcontext-diagnoseunintendedobjcmethodoverrides.swift
./validation-test/compiler_crashers_fixed/00997-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/27640-swift-functiontype-get.swift
./validation-test/compiler_crashers_fixed/27211-llvm-foldingsetnodeid-operator.swift
./validation-test/compiler_crashers_fixed/25945-swift-conformancelookuptable-expandimpliedconformances.swift
./validation-test/compiler_crashers_fixed/25852-swift-funcdecl-create.swift
./validation-test/compiler_crashers_fixed/27911-swift-declcontext-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/25766-swift-parser-parsedecl.swift
./validation-test/compiler_crashers_fixed/00642-llvm-errs.swift
./validation-test/compiler_crashers_fixed/01854-llvm-foldingset-swift-boundgenerictype-nodeequals.swift
./validation-test/compiler_crashers_fixed/28639-unreachable-executed-at-swift-lib-ast-type-cpp-1337.swift
./validation-test/compiler_crashers_fixed/28598-issatisfied-request.swift
./validation-test/compiler_crashers_fixed/26060-swift-parser-parsetypeidentifier.swift
./validation-test/compiler_crashers_fixed/01573-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/00579-llvm-ondiskchainedhashtable-swift-modulefile-decltableinfo-find.swift
./validation-test/compiler_crashers_fixed/01816-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/01372-swift-boundgenerictype-get.swift
./validation-test/compiler_crashers_fixed/01348-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/01320-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/26459-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/27158-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/01443-swift-lexer-leximpl.swift
./validation-test/compiler_crashers_fixed/25662-swift-valuedecl-settype.swift
./validation-test/compiler_crashers_fixed/27145-swift-archetypebuilder-addgenericsignature.swift
./validation-test/compiler_crashers_fixed/28248-swift-dynamicselftype-get.swift
./validation-test/compiler_crashers_fixed/00621-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/25706-swift-genericsignature-get.swift
./validation-test/compiler_crashers_fixed/27641-swift-parser-parseexprpostfix.swift
./validation-test/compiler_crashers_fixed/25401-swift-functiontype-get.swift
./validation-test/compiler_crashers_fixed/26326-swift-parser-parseexprpostfix.swift
./validation-test/compiler_crashers_fixed/00219-swift-module-isstdlibmodule.swift
./validation-test/compiler_crashers_fixed/26904-swift-typechecker-definedefaultconstructor.swift
./validation-test/compiler_crashers_fixed/28119-void.swift
./validation-test/compiler_crashers_fixed/27792-swift-funcdecl-setdeserializedsignature.swift
./validation-test/compiler_crashers_fixed/27454-swift-parser-parsetoken.swift
./validation-test/compiler_crashers_fixed/27596-llvm-foldingset-swift-enumtype-nodeequals.swift
./validation-test/compiler_crashers_fixed/00708-swift-parser-parsetoken.swift
./validation-test/compiler_crashers_fixed/25389-swift-funcdecl-setdeserializedsignature.swift
./validation-test/compiler_crashers_fixed/02114-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/27997-swift-typechecker-computeaccessibility.swift
./validation-test/compiler_crashers_fixed/02180-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/26408-swift-iterabledeclcontext-addmember.swift
./validation-test/compiler_crashers_fixed/00941-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/27514-swift-constraints-constraintsystem-getconstraintlocator.swift
./validation-test/compiler_crashers_fixed/25905-swift-genericsignature-genericsignature.swift
./validation-test/compiler_crashers_fixed/00441-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/00856-swift-clangmoduleunit-getimportedmodules.swift
./validation-test/compiler_crashers_fixed/00538-swift-clangmoduleunit-getadaptermodule.swift
./validation-test/compiler_crashers_fixed/26452-swift-sourcemanager-extracttext.swift
./validation-test/compiler_crashers_fixed/27572-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/26837-swift-abstractfunctiondecl-getobjcselector.swift
./validation-test/compiler_crashers_fixed/26846-formatdiagnostictext.swift
./validation-test/compiler_crashers_fixed/26739-llvm-bitstreamcursor-read.swift
./validation-test/compiler_crashers_fixed/26791-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/02025-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/00202-swift-parser-parseexprpostfix.swift
./validation-test/compiler_crashers_fixed/28061-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/02043-std-function-func-swift-constraints-solution-computesubstitutions.swift
./validation-test/compiler_crashers_fixed/00799-e.swift
./validation-test/compiler_crashers_fixed/00746-vtable.swift
./validation-test/compiler_crashers_fixed/00608-swift-typebase-getanyoptionalobjecttype.swift
./validation-test/compiler_crashers_fixed/26875-swift-typechecker-checkunsupportedprotocoltype.swift
./validation-test/compiler_crashers_fixed/00210-swift-constraints-constraintsystem-simplifyconformstoconstraint.swift
./validation-test/compiler_crashers_fixed/00520-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/26430-swift-expr-walk.swift
./validation-test/compiler_crashers_fixed/25958-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/28810-swift-unqualifiedlookup-unqualifiedlookup-swift-declname-swift-declcontext-swift.swift
./validation-test/compiler_crashers_fixed/28359-swift-constraints-constraintsystem-addtypevariableconstraintstoworklist.swift
./validation-test/compiler_crashers_fixed/01417-swift-extensiondecl-create.swift
./validation-test/compiler_crashers_fixed/27171-swift-typebase-getanyoptionalobjecttype.swift
./validation-test/compiler_crashers_fixed/28399-getpointerelementtype-is-not-storagetype.swift
./validation-test/compiler_crashers_fixed/28101-swift-constraints-constraint-create.swift
./validation-test/compiler_crashers_fixed/28430-swift-lexer-lexoperatoridentifier.swift
./validation-test/compiler_crashers_fixed/28679-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/25597-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/27128-swift-nominaltypedecl-preparelookuptable.swift
./validation-test/compiler_crashers_fixed/25685-swift-parser-parsedeclenum.swift
./validation-test/compiler_crashers_fixed/28397-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/25639-swift-valuedecl-settype.swift
./validation-test/compiler_crashers_fixed/01734-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/00196-swift-constraints-constraint-create.swift
./validation-test/compiler_crashers_fixed/00915-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/00410-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/26294-void.swift
./validation-test/compiler_crashers_fixed/27808-swift-constructordecl-constructordecl.swift
./validation-test/compiler_crashers_fixed/02238-swift-typechecker-coercepatterntotype.swift
./validation-test/compiler_crashers_fixed/01233-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/25906-swift-typechecker-checkdeclarationavailability.swift
./validation-test/compiler_crashers_fixed/02094-swift-typechecker-resolvetypeincontext.swift
./validation-test/compiler_crashers_fixed/00335-llvm-raw-fd-ostream-write-impl.swift
./validation-test/compiler_crashers_fixed/26863-swift-constraints-constraintsystem-simplifyconstraint.swift
./validation-test/compiler_crashers_fixed/26484-swift-lexer-leximpl.swift
./validation-test/compiler_crashers_fixed/02236-swift-nominaltypedecl-computetype.swift
./validation-test/compiler_crashers_fixed/26226-swift-constraints-constraintsystem-assignfixedtype.swift
./validation-test/compiler_crashers_fixed/00917-swift-lexer-leximpl.swift
./validation-test/compiler_crashers_fixed/00341-cleanupillformedexpression.swift
./validation-test/compiler_crashers_fixed/27403-swift-typechecker-resolveinheritanceclause.swift
./validation-test/compiler_crashers_fixed/27703-swift-astprinter-printtextimpl.swift
./validation-test/compiler_crashers_fixed/27673-swift-parser-parseidentifier.swift
./validation-test/compiler_crashers_fixed/25531-swift-abstractclosureexpr-setparams.swift
./validation-test/compiler_crashers_fixed/25471-swift-iterabledeclcontext-setloader.swift
./validation-test/compiler_crashers_fixed/27275-swift-genericfunctiontype-get.swift
./validation-test/compiler_crashers_fixed/26446-swift-generictypeparamtype-get.swift
./validation-test/compiler_crashers_fixed/00883-t.swift
./validation-test/compiler_crashers_fixed/00722-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/00085-swift-typechecker-typecheckpattern.swift
./validation-test/compiler_crashers_fixed/26332-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/27008-llvm-optional-swift-diagnostic-operator.swift
./validation-test/compiler_crashers_fixed/01539-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/02024-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/01547-swift-modulefile-lookupvalue.swift
./validation-test/compiler_crashers_fixed/26345-swift-constraints-solution-solution.swift
./validation-test/compiler_crashers_fixed/25816-swift-parser-parsedeclclass.swift
./validation-test/compiler_crashers_fixed/01903-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/27080-swift-typechecker-typecheckpattern.swift
./validation-test/compiler_crashers_fixed/02235-swift-declname-printpretty.swift
./validation-test/compiler_crashers_fixed/26858-swift-streamprinter-printtext.swift
./validation-test/compiler_crashers_fixed/27496-swift-modulefile-declcommenttableinfo-readdata.swift
./validation-test/compiler_crashers_fixed/26544-swift-sourcefile-lookupcache-lookupvalue.swift
./validation-test/compiler_crashers_fixed/28696-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/28398-swift-archetypebuilder-getgenericsignature.swift
./validation-test/compiler_crashers_fixed/27151-swift-expr-walk.swift
./validation-test/compiler_crashers_fixed/27637-swift-typechecker-checkunsupportedprotocoltype.swift
./validation-test/compiler_crashers_fixed/27789-swift-constraints-constraintsystem-addtypevariableconstraintstoworklist.swift
./validation-test/compiler_crashers_fixed/01282-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/26664-swift-parser-skipsingle.swift
./validation-test/compiler_crashers_fixed/28528-replacement-ismaterializable-cannot-substitute-with-a-non-materializable-type.swift
./validation-test/compiler_crashers_fixed/27487-swift-sourcemanager-addnewsourcebuffer.swift
./validation-test/compiler_crashers_fixed/27318-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/00337-swift-typechecker-checksubstitutions.swift
./validation-test/compiler_crashers_fixed/00660-swift-modulefile-getdecl.swift
./validation-test/compiler_crashers_fixed/00929-swift-tupletype-get.swift
./validation-test/compiler_crashers_fixed/26370-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/27797-swift-typechecker-typecheckbinding.swift
./validation-test/compiler_crashers_fixed/00104-swift-constraints-constraintsystem-finalize.swift
./validation-test/compiler_crashers_fixed/28327-swift-expr-walk.swift
./validation-test/compiler_crashers_fixed/27469-swift-patternbindingdecl-create.swift
./validation-test/compiler_crashers_fixed/01718-swift-nominaltypedecl-preparelookuptable.swift
./validation-test/compiler_crashers_fixed/28838-gpdecl-getdepth-generictypeparamdecl-invaliddepth-parameter-hasnt-been-validated.swift
./validation-test/compiler_crashers_fixed/25821-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/26751-swift-lexer-kindofidentifier.swift
./validation-test/compiler_crashers_fixed/00261-swift-parser-parseexprpostfix.swift
./validation-test/compiler_crashers_fixed/01749-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/00129-swift-lexer-lexidentifier.swift
./validation-test/compiler_crashers_fixed/26254-swift-constraints-constraintsystem-solvesimplified.swift
./validation-test/compiler_crashers_fixed/28715-isactuallycanonicalornull-forming-a-cantype-out-of-a-non-canonical-type.swift
./validation-test/compiler_crashers_fixed/01146-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/01605-swift-protocoltype-canonicalizeprotocols.swift
./validation-test/compiler_crashers_fixed/25699-swift-sourcefile-getcache.swift
./validation-test/compiler_crashers_fixed/00789-swift-typebase-isexistentialtype.swift
./validation-test/compiler_crashers_fixed/00294-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/27202-swift-parser-consumetoken.swift
./validation-test/compiler_crashers_fixed/25613-llvm-foldingset-swift-classtype-nodeequals.swift
./validation-test/compiler_crashers_fixed/27723-swift-constraints-constraint-createbindoverload.swift
./validation-test/compiler_crashers_fixed/02222-swift-generictypeparamdecl-generictypeparamdecl.swift
./validation-test/compiler_crashers_fixed/27929-swift-clangimporter-lookupvalue.swift
./validation-test/compiler_crashers_fixed/27526-swift-structtype-get.swift
./validation-test/compiler_crashers_fixed/01631-swift-constraints-solution-solution.swift
./validation-test/compiler_crashers_fixed/27821-swift-typechecker-definedefaultconstructor.swift
./validation-test/compiler_crashers_fixed/01551-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/28381-swift-archetypebuilder-addrequirement.swift
./validation-test/compiler_crashers_fixed/28350-swift-typechecker-performtypocorrection.swift
./validation-test/compiler_crashers_fixed/26409-swift-tuplepattern-createsimple.swift
./validation-test/compiler_crashers_fixed/28780-hasinterfacetype-no-interface-type-was-set.swift
./validation-test/compiler_crashers_fixed/27178-vtable.swift
./validation-test/compiler_crashers_fixed/28295-swift-namelookup-lookupvisibledeclsinmodule.swift
./validation-test/compiler_crashers_fixed/26663-swift-parser-parseexprcallsuffix.swift
./validation-test/compiler_crashers_fixed/01872-void.swift
./validation-test/compiler_crashers_fixed/28167-swift-generictypeparamtype-get.swift
./validation-test/compiler_crashers_fixed/25365-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/00638-swift-typechecker-typecheckexpressionshallow.swift
./validation-test/compiler_crashers_fixed/26583-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/26343-swift-constraints-constraintsystem-simplify.swift
./validation-test/compiler_crashers_fixed/28441-swift-typerepr-walk.swift
./validation-test/compiler_crashers_fixed/00416-swift-typechecker-conformstoprotocol.swift
./validation-test/compiler_crashers_fixed/01655-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/01111-swift-astcontext-setconformsto.swift
./validation-test/compiler_crashers_fixed/26939-swift-patternbindingdecl-setpattern.swift
./validation-test/compiler_crashers_fixed/28059-swift-conformancelookuptable-updatelookuptable.swift
./validation-test/compiler_crashers_fixed/00872-swift-parser-parseidentifier.swift
./validation-test/compiler_crashers_fixed/00147-swift-parser-parseexprstringliteral.swift
./validation-test/compiler_crashers_fixed/00629-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/00819-swift-constraints-constraintsystem-opengeneric.swift
./validation-test/compiler_crashers_fixed/01591-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/27013-mapsignaturefunctiontype.swift
./validation-test/compiler_crashers_fixed/25413-llvm-errs.swift
./validation-test/compiler_crashers_fixed/28236-swift-typebase-getmembersubstitutions.swift
./validation-test/compiler_crashers_fixed/00443-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/26064-bool.swift
./validation-test/compiler_crashers_fixed/01452-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/00156-swift-protocoltype-canonicalizeprotocols.swift
./validation-test/compiler_crashers_fixed/01598-swift-constraints-constraintsystem-getconstraintlocator.swift
./validation-test/compiler_crashers_fixed/26061-swift-removeshadoweddecls.swift
./validation-test/compiler_crashers_fixed/26528-swift-modulefile-lookupvalue.swift
./validation-test/compiler_crashers_fixed/28219-swift-lvaluetype-get.swift
./validation-test/compiler_crashers_fixed/26779-swift-parser-diagnose.swift
./validation-test/compiler_crashers_fixed/01925-swift-parser-consumetoken.swift
./validation-test/compiler_crashers_fixed/01766-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/02153-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/01221-swift-typealiasdecl-typealiasdecl.swift
./validation-test/compiler_crashers_fixed/28202-swift-typechecker-applygenericarguments.swift
./validation-test/compiler_crashers_fixed/27656-swift-abstractfunctiondecl-getobjcselector.swift
./validation-test/compiler_crashers_fixed/01699-llvm-foldingset-swift-tupletype-nodeequals.swift
./validation-test/compiler_crashers_fixed/02096-swift-functiontype-get.swift
./validation-test/compiler_crashers_fixed/26348-swift-unqualifiedlookup-unqualifiedlookup.swift
./validation-test/compiler_crashers_fixed/27103-swift-typebase-getanyoptionalobjecttype.swift
./validation-test/compiler_crashers_fixed/25379-llvm-foldingset-swift-tupletype-nodeequals.swift
./validation-test/compiler_crashers_fixed/26916-swift-typechecker-definedefaultconstructor.swift
./validation-test/compiler_crashers_fixed/01661-swift-parser-parsedeclfunc.swift
./validation-test/compiler_crashers_fixed/28408-swift-typechecker-checkinheritanceclause.swift
./validation-test/compiler_crashers_fixed/27974-swift-inflightdiagnostic-fixitreplacechars.swift
./validation-test/compiler_crashers_fixed/26316-swift-genericparamlist-create.swift
./validation-test/compiler_crashers_fixed/01153-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/00572-resolvetypedecl.random.swift
./validation-test/compiler_crashers_fixed/28663-impl-getgraphindex-typevariables-size-out-of-bounds-index.swift
./validation-test/compiler_crashers_fixed/00444-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/26833-llvm-mapvector-swift-declcontext.swift
./validation-test/compiler_crashers_fixed/28192-swift-genericfunctiontype-get.swift
./validation-test/compiler_crashers_fixed/02088-swift-constraints-constraintsystem-matchfunctiontypes.swift
./validation-test/compiler_crashers_fixed/01724-llvm-tinyptrvector-swift-valuedecl-push-back.swift
./validation-test/compiler_crashers_fixed/02066-swift-constraints-constraintsystem-getfixedtyperecursive.swift
./validation-test/compiler_crashers_fixed/01527-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/01955-std-function-func-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/28018-swift-valuedecl-overwritetype.swift
./validation-test/compiler_crashers_fixed/25528-swift-iterabledeclcontext-getmembers.swift
./validation-test/compiler_crashers_fixed/25440-swift-typeloc-iserror.swift
./validation-test/compiler_crashers_fixed/26403-llvm-densemapbase-llvm-smalldensemap-std-pair-llvm-arrayref-std-pair-swift-identifier.swift
./validation-test/compiler_crashers_fixed/27492-swift-inouttype-get.swift
./validation-test/compiler_crashers_fixed/26565-swift-constraints-constraintsystem-salvage.swift
./validation-test/compiler_crashers_fixed/00476-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/00624-swift-constraints-solution-solution.swift
./validation-test/compiler_crashers_fixed/00827-swift-modulefile-maybereadpattern.swift
./validation-test/compiler_crashers_fixed/01308-std-function-func-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/27125-swift-typechecker-coercepatterntotype.swift
./validation-test/compiler_crashers_fixed/27741-swift-structtype-get.swift
./validation-test/compiler_crashers_fixed/27155-swift-attributebase-operator.swift
./validation-test/compiler_crashers_fixed/26579-swift-typechecker-overapproximateosversionsatlocation.swift
./validation-test/compiler_crashers_fixed/01676-swift-parser-parseexprsequence.swift
./validation-test/compiler_crashers_fixed/28795-inprotocol-isrequirementsignaturecomputed-missing-signature.swift
./validation-test/compiler_crashers_fixed/28514-assign-isfolded-already-folded-assign-expr-in-sequence.swift
./validation-test/compiler_crashers_fixed/25384-swift-constraints-constraintsystem-opengeneric.swift
./validation-test/compiler_crashers_fixed/27273-swift-constraints-constraintsystem-solvesimplified.swift
./validation-test/compiler_crashers_fixed/25488-std-function-func-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/25594-swift-dependentmembertype-get.swift
./validation-test/compiler_crashers_fixed/01531-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/23060-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/27873-void.swift
./validation-test/compiler_crashers_fixed/25863-swift-lexer-leximpl.swift
./validation-test/compiler_crashers_fixed/06252-swift-typechecker-conformstoprotocol.swift
./validation-test/compiler_crashers_fixed/28171-swift-partialgenerictypetoarchetyperesolver-resolvegenerictypeparamtype.swift
./validation-test/compiler_crashers_fixed/27251-swift-nominaltype-get.swift
./validation-test/compiler_crashers_fixed/01716-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/01457-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/27234-swift-protocoldecl-existentialtypesupportedslow.swift
./validation-test/compiler_crashers_fixed/28405-swift-constraints-constraintsystem-resolveoverload.swift
./validation-test/compiler_crashers_fixed/28486-this-genericenv-already-have-generic-context.swift
./validation-test/compiler_crashers_fixed/01467-swift-inouttype-get.swift
./validation-test/compiler_crashers_fixed/26859-swift-classdecl-classdecl.swift
./validation-test/compiler_crashers_fixed/25711-swift-constraints-constraintsystem-optimizeconstraints.swift
./validation-test/compiler_crashers_fixed/26641-swift-parser-skipsingle.swift
./validation-test/compiler_crashers_fixed/01441-swift-constraints-constraintgraph-removeconstraint.swift
./validation-test/compiler_crashers_fixed/26117-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/25865-llvm-raw-fd-ostream-write-impl.swift
./validation-test/compiler_crashers_fixed/26513-swift-constraints-constraintsystem-getconstraintlocator.swift
./validation-test/compiler_crashers_fixed/26355-llvm-smallvectorimpl-swift-diagnosticargument-operator.swift
./validation-test/compiler_crashers_fixed/28668-activediagnostic-already-have-an-active-diagnostic.swift
./validation-test/compiler_crashers_fixed/28794-swift-type-transformrec-llvm-function-ref-llvm-optional-swift-type-swift-typebas.swift
./validation-test/compiler_crashers_fixed/27292-swift-abstractclosureexpr-setparams.swift
./validation-test/compiler_crashers_fixed/01199-swift-constraints-constraintsystem-opengeneric.swift
./validation-test/compiler_crashers_fixed/00549-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/01834-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/26539-swift-constraints-constraintsystem-simplifytype.swift
./validation-test/compiler_crashers_fixed/00968-swift-typebase-isexistentialtype.swift
./validation-test/compiler_crashers_fixed/00474-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/26108-swift-genericparamlist-deriveallarchetypes.swift
./validation-test/compiler_crashers_fixed/00892-swift-protocoltype-canonicalizeprotocols.swift
./validation-test/compiler_crashers_fixed/28118-resolveidenttypecomponent.swift
./validation-test/compiler_crashers_fixed/00577-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/02248-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/26725-llvm-smallvectorimpl-swift-diagnosticargument-operator.swift
./validation-test/compiler_crashers_fixed/25974-swift-parser-parseexprcallsuffix.swift
./validation-test/compiler_crashers_fixed/28742-swift-type-subst-llvm-function-ref-swift-type-swift-substitutabletype-llvm-funct.swift
./validation-test/compiler_crashers_fixed/26147-llvm-foldingset-swift-classtype-nodeequals.swift
./validation-test/compiler_crashers_fixed/25723-swift-typechecker-checkinheritanceclause.swift
./validation-test/compiler_crashers_fixed/26836-swift-conformancelookuptable-lookupconformances.swift
./validation-test/compiler_crashers_fixed/28406-swift-decomposeparamtype.swift
./validation-test/compiler_crashers_fixed/01832-swift-lexer-leximpl.swift
./validation-test/compiler_crashers_fixed/28076-llvm-foldingset-swift-tupletype-getnodeprofile.swift
./validation-test/compiler_crashers_fixed/26481-swift-genericsignature-get.swift
./validation-test/compiler_crashers_fixed/01253-swift-tuplepattern-createsimple.swift
./validation-test/compiler_crashers_fixed/26732-std-function-func-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/01068-swift-modulefile-getdecl.swift
./validation-test/compiler_crashers_fixed/02027-swift-unboundgenerictype-get.swift
./validation-test/compiler_crashers_fixed/01983-std-function-func-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/00540-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/26123-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/01149-llvm-foldingsetnodeid-operator.swift
./validation-test/compiler_crashers_fixed/25953-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/26412-swift-parser-parseexprclosure.swift
./validation-test/compiler_crashers_fixed/00277-swift-typechecker-getinterfacetypefrominternaltype.swift
./validation-test/compiler_crashers_fixed/01001-swift-parser-parsedeclimport.swift
./validation-test/compiler_crashers_fixed/26321-swift-genericparamlist-create.swift
./validation-test/compiler_crashers_fixed/28220-swift-lvaluetype-get.swift
./validation-test/compiler_crashers_fixed/01030-swift-declname-printpretty.swift
./validation-test/compiler_crashers_fixed/25643-swift-markasobjc.swift
./validation-test/compiler_crashers_fixed/00943-swift-diagnosticengine-diagnose.swift
./validation-test/compiler_crashers_fixed/00208-swift-typebase-getanyoptionalobjecttype.swift
./validation-test/compiler_crashers_fixed/00620-llvm-bitstreamcursor-readabbreviatedfield.swift
./validation-test/compiler_crashers_fixed/28039-swift-constraints-solution-computesubstitutions.swift
./validation-test/compiler_crashers_fixed/28102-swift-parser-parseidentifier.swift
./validation-test/compiler_crashers_fixed/26561-swift-sourcemanager-extracttext.swift
./validation-test/compiler_crashers_fixed/02128-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/00672-swift-diagnosticengine-diagnose.swift
./validation-test/compiler_crashers_fixed/02007-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/01864-swift-valuedecl-settype.swift
./validation-test/compiler_crashers_fixed/02095-swift-constraints-constraintsystem-addtypevariableconstraintstoworklist.swift
./validation-test/compiler_crashers_fixed/00755-swift-genericfunctiontype-get.swift
./validation-test/compiler_crashers_fixed/26705-swift-constraints-constraintsystem-finalize.swift
./validation-test/compiler_crashers_fixed/00302-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/25900-swift-constraints-constraintsystem-matchtypes.swift
./validation-test/compiler_crashers_fixed/27113-swift-nominaltypedecl-getmembers.swift
./validation-test/compiler_crashers_fixed/25491-swift-parser-parsebraceitems.swift
./validation-test/compiler_crashers_fixed/27919-swift-stmt-walk.swift
./validation-test/compiler_crashers_fixed/00276-llvm-errs.swift
./validation-test/compiler_crashers_fixed/27363-swift-type-transform.swift
./validation-test/compiler_crashers_fixed/00674-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/01196-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/27164-swift-parser-parsetypeidentifier.swift
./validation-test/compiler_crashers_fixed/00328-swift-parser-parseidentifier.swift
./validation-test/compiler_crashers_fixed/25788-swift-astcontext-implementation-implementation.swift
./validation-test/compiler_crashers_fixed/02228-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/00824-x.swift
./validation-test/compiler_crashers_fixed/00386-swift-constraints-constraintsystem-getfixedtyperecursive.swift
./validation-test/compiler_crashers_fixed/27517-swift-valuedecl-overwritetype.swift
./validation-test/compiler_crashers_fixed/27670-swift-unqualifiedlookup-unqualifiedlookup.swift
./validation-test/compiler_crashers_fixed/01977-swift-constraints-constraintgraph-addconstraint.swift
./validation-test/compiler_crashers_fixed/00332-swift-typechecker-getbridgedtoobjc.swift
./validation-test/compiler_crashers_fixed/27772-swift-modulefile-loadextensions.swift
./validation-test/compiler_crashers_fixed/27050-swift-typechecker-coercepatterntotype.swift
./validation-test/compiler_crashers_fixed/27296-swift-astcontext-getstringdecl.swift
./validation-test/compiler_crashers_fixed/02081-swift-inouttype-get.swift
./validation-test/compiler_crashers_fixed/00069-swift-typevisitor.swift
./validation-test/compiler_crashers_fixed/27196-swift-typebase-getanyoptionalobjecttype.swift
./validation-test/compiler_crashers_fixed/27795-swift-typebase-isequal.swift
./validation-test/compiler_crashers_fixed/01350-swift-clangmoduleunit-getadaptermodule.swift
./validation-test/compiler_crashers_fixed/26048-swift-genericparamlist-create.swift
./validation-test/compiler_crashers_fixed/28638-anonymous-namespace-verifier-checksametype-swift-type-swift-type-char-const.swift
./validation-test/compiler_crashers_fixed/27781-swift-typechecker-resolvetypeincontext.swift
./validation-test/compiler_crashers_fixed/00985-swift-constraints-constraintsystem-getfixedtyperecursive.swift
./validation-test/compiler_crashers_fixed/01884-swift-typechecker-resolvetypeincontext.swift
./validation-test/compiler_crashers_fixed/27953-swift-modulefile-getcommentfordecl.swift
./validation-test/compiler_crashers_fixed/01272-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/01768-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/27890-swift-typechecker-validategenerictypesignature.swift
./validation-test/compiler_crashers_fixed/26784-swift-constraints-constraintsystem-solve.swift
./validation-test/compiler_crashers_fixed/25559-swift-lexer-leximpl.swift
./validation-test/compiler_crashers_fixed/27677-std-function-func-swift-constraints-constraintsystem-simplifytype.swift
./validation-test/compiler_crashers_fixed/26041-swift-astcontext-getidentifier.swift
./validation-test/compiler_crashers_fixed/26743-swift-typechecker-checkinheritanceclause.swift
./validation-test/compiler_crashers_fixed/26199-swift-modulefile-lookupvalue.swift
./validation-test/compiler_crashers_fixed/00290-swift-declcontext-lookupqualified.swift
./validation-test/compiler_crashers_fixed/27346-swift-markasobjc.swift
./validation-test/compiler_crashers_fixed/00407-void.swift
./validation-test/compiler_crashers_fixed/02001-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/00749-swift-clangmoduleunit-getadaptermodule.swift
./validation-test/compiler_crashers_fixed/01366-swift-constraints-constraintsystem-simplifyconstraint.swift
./validation-test/compiler_crashers_fixed/26138-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/27142-swift-constraints-constraintsystem-simplifyconstraint.swift
./validation-test/compiler_crashers_fixed/25925-llvm-smallvectorimpl-swift-diagnosticargument-operator.swift
./validation-test/compiler_crashers_fixed/26621-swift-astcontext-allocate.swift
./validation-test/compiler_crashers_fixed/27289-swift-unqualifiedlookup-unqualifiedlookup.swift
./validation-test/compiler_crashers_fixed/00812-swift-modulefile-gettype.swift
./validation-test/compiler_crashers_fixed/00610-swift-diagnosticengine-flushactivediagnostic.swift
./validation-test/compiler_crashers_fixed/26319-swift-genericparamlist-addnestedarchetypes.swift
./validation-test/compiler_crashers_fixed/25618-swift-constraints-constraintsystem-simplifytype.swift
./validation-test/compiler_crashers_fixed/01480-swift-typebase-getcanonicaltype-edited.swift
./validation-test/compiler_crashers_fixed/00737-bool.swift
./validation-test/compiler_crashers_fixed/01627-swift-modulefile-gettype.swift
./validation-test/compiler_crashers_fixed/26792-swift-classtype-get.swift
./validation-test/compiler_crashers_fixed/28287-swift-type-transform.swift
./validation-test/compiler_crashers_fixed/28458-resultreplacement-istypeparameter-cant-be-dependent.swift
./validation-test/compiler_crashers_fixed/28836-functy-hasarchetype.swift
./validation-test/compiler_crashers_fixed/27602-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/28851-hasconformanceinsignature-inprotocol-getrequirementsignature-subjecttype-conform.swift
./validation-test/compiler_crashers_fixed/00118-swift-dependentgenerictyperesolver-resolvegenerictypeparamtype.swift
./validation-test/compiler_crashers_fixed/28746-second-missing-second-type.swift
./validation-test/compiler_crashers_fixed/27006-formatdiagnostictext.swift
./validation-test/compiler_crashers_fixed/25984-swift-lexer-getlocforendoftoken.swift
./validation-test/compiler_crashers_fixed/02203-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/27482-swift-parser-parseexprpostfix.swift
./validation-test/compiler_crashers_fixed/26473-swift-constraints-constraint-constraint.swift
./validation-test/compiler_crashers_fixed/25682-swift-modulefile-gettype.swift
./validation-test/compiler_crashers_fixed/01981-swift-modulefile-maybereadgenericparams.swift
./validation-test/compiler_crashers_fixed/00320-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/28825-isa-classdecl-nominaldecl-expected-a-class-here.swift
./validation-test/compiler_crashers_fixed/00541-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/25368-swift-genericfunctiontype-get.swift
./validation-test/compiler_crashers_fixed/00843-anyobject.swift
./validation-test/compiler_crashers_fixed/28511-swift-astvisitor-anonymous-namespace-attributechecker-void-void-void-void-void-v.swift
./validation-test/compiler_crashers_fixed/28547-env-dependent-type-in-non-generic-context.swift
./validation-test/compiler_crashers_fixed/01326-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/27089-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/00766-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/02182-swift-streamprinter-printtext.swift
./validation-test/compiler_crashers_fixed/28557-swift-astvisitor-anonymous-namespace-printtyperepr-void-void-void-void-void-void.swift
./validation-test/compiler_crashers_fixed/00134-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/27796-swift-modulefile-maybereadforeignerrorconvention.swift
./validation-test/compiler_crashers_fixed/27005-vtable.swift
./validation-test/compiler_crashers_fixed/26460-std-function-func-swift-constraints-solution-simplifytype.swift
./validation-test/compiler_crashers_fixed/00365-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/01432-swift-bracestmt-create.swift
./validation-test/compiler_crashers_fixed/28124-swift-typevisitor.swift
./validation-test/compiler_crashers_fixed/01596-llvm-bitstreamcursor-readvbr.swift
./validation-test/compiler_crashers_fixed/28645-swift-type-transform-llvm-function-ref-swift-type-swift-type-const.swift
./validation-test/compiler_crashers_fixed/26081-std-function-func-swift-constraints-constraintsystem-simplifytype.swift
./validation-test/compiler_crashers_fixed/00434-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/00502-swift-constraints-constraintsystem-diagnosefailurefromconstraints.swift
./validation-test/compiler_crashers_fixed/02195-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/26419-swift-modulefile-gettype.swift
./validation-test/compiler_crashers_fixed/01304-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/26508-llvm-smallvectorbase-grow-pod.swift
./validation-test/compiler_crashers_fixed/01776-swift-availabilityattr-isunavailable.swift
./validation-test/compiler_crashers_fixed/27267-swift-genericparamlist-create.swift
./validation-test/compiler_crashers_fixed/00123-swift-functiontype-get.swift
./validation-test/compiler_crashers_fixed/00555-swift-optional-swift-diagnostic-operator.swift
./validation-test/compiler_crashers_fixed/00636-llvm-twine-str.swift
./validation-test/compiler_crashers_fixed/28482-hasaccessibility-accessibility-not-computed-yet.swift
./validation-test/compiler_crashers_fixed/01364-swift-enumtype-get.swift
./validation-test/compiler_crashers_fixed/02064-swift-diagnosticengine-diagnose.swift
./validation-test/compiler_crashers_fixed/26491-swift-abstractstoragedecl-makecomputed.swift
./validation-test/compiler_crashers_fixed/28106-swift-astcontext-setrawcomment.swift
./validation-test/compiler_crashers_fixed/28138-swift-constraints-constraintsystem-addoverloadset.swift
./validation-test/compiler_crashers_fixed/02016-swift-tuplepattern-create.swift
./validation-test/compiler_crashers_fixed/26992-swift-archetypetype-getnew.swift
./validation-test/compiler_crashers_fixed/00213-swift-typechecker-validatetype.swift
./validation-test/compiler_crashers_fixed/26101-swift-parser-parsenewdeclattribute.swift
./validation-test/compiler_crashers_fixed/01265-getcallerdefaultarg.swift
./validation-test/compiler_crashers_fixed/01376-swift-parser-parsetoken.swift
./validation-test/compiler_crashers_fixed/00786-end.swift
./validation-test/compiler_crashers_fixed/25462-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/27195-swift-protocoltype-canonicalizeprotocols.swift
./validation-test/compiler_crashers_fixed/28099-swift-conformancelookuptable-updatelookuptable.swift
./validation-test/compiler_crashers_fixed/26647-swift-parser-skipsingle.swift
./validation-test/compiler_crashers_fixed/00215-swift-optional-swift-infixoperatordecl.swift
./validation-test/compiler_crashers_fixed/25565-swift-modulefile-loadextensions.swift
./validation-test/compiler_crashers_fixed/26595-swift-lexer-lexoperatoridentifier.swift
./validation-test/compiler_crashers_fixed/26036-bool.swift
./validation-test/compiler_crashers_fixed/00182-swift-astcontext-getconformance.swift
./validation-test/compiler_crashers_fixed/28752-hasinterfacetype-no-interface-type-was-set.swift
./validation-test/compiler_crashers_fixed/00850-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/26860-swift-typebase-gatherallsubstitutions.swift
./validation-test/compiler_crashers_fixed/27029-swift-typebase-isemptyexistentialcomposition.swift
./validation-test/compiler_crashers_fixed/27419-swift-boundgenerictype-get.swift
./validation-test/compiler_crashers_fixed/27254-swift-functiontype-get.swift
./validation-test/compiler_crashers_fixed/26144-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/26500-swift-modulefile-getdeclcontext.swift
./validation-test/compiler_crashers_fixed/28416-swift-typechecker-resolveidentifiertype.swift
./validation-test/compiler_crashers_fixed/25730-swift-nominaltypedecl-computeinterfacetype.swift
./validation-test/compiler_crashers_fixed/25759-swift-typechecker-overapproximateosversionsatlocation.swift
./validation-test/compiler_crashers_fixed/01902-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/02137-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/00900-swift-functiontype-get.swift
./validation-test/compiler_crashers_fixed/26940-swift-conformancelookuptable-getconformance.swift
./validation-test/compiler_crashers_fixed/27394-swift-type-transform.swift
./validation-test/compiler_crashers_fixed/27247-swift-constraints-constraintsystem-simplifyconstraint.swift
./validation-test/compiler_crashers_fixed/25708-swift-typechecker-resolvetypeincontext.swift
./validation-test/compiler_crashers_fixed/01798-swift-typechecker-coercepatterntotype.swift
./validation-test/compiler_crashers_fixed/26056-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/27836-llvm-foldingset-swift-constraints-constraintlocator-nodeequals.swift
./validation-test/compiler_crashers_fixed/25603-swift-sourcemanager-extracttext.swift
./validation-test/compiler_crashers_fixed/27489-swift-typechecker-checkgenericarguments.swift
./validation-test/compiler_crashers_fixed/28695-unreachable-executed-at-swift-lib-ast-type-cpp-1351.swift
./validation-test/compiler_crashers_fixed/01524-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/27041-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/00250-swift-parser-consumestartinggreater.swift
./validation-test/compiler_crashers_fixed/28636-base-base-hastypeparameter.swift
./validation-test/compiler_crashers_fixed/27813-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/27422-swift-lexer-leximpl.swift
./validation-test/compiler_crashers_fixed/26458-swift-constraints-constraintsystem-simplifymemberconstraint.swift
./validation-test/compiler_crashers_fixed/00228-swift-clangimporter-loadextensions.swift
./validation-test/compiler_crashers_fixed/26129-swift-typechecker-getinterfacetypefrominternaltype.swift
./validation-test/compiler_crashers_fixed/28801-swift-typebase-getcontextsubstitutions-swift-declcontext-const-swift-genericenvi.swift
./validation-test/compiler_crashers_fixed/26067-swift-sourcemanager-extracttext.swift
./validation-test/compiler_crashers_fixed/28713-swift-typebase-getdesugaredtype.swift
./validation-test/compiler_crashers_fixed/02106-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/00432-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/00359-swift-constraints-constraintsystem-getfixedtyperecursive.swift
./validation-test/compiler_crashers_fixed/26735-swift-typechecker-overapproximateosversionsatlocation.swift
./validation-test/compiler_crashers_fixed/26821-swift-declcontext-getlocalconformances.swift
./validation-test/compiler_crashers_fixed/00121-swift-diagnosticengine-diagnose.swift
./validation-test/compiler_crashers_fixed/01140-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/26014-swift-conformancelookuptable-getallprotocols.swift
./validation-test/compiler_crashers_fixed/27540-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/25459-swift-declcontext-lookupqualified.swift
./validation-test/compiler_crashers_fixed/26618-swift-sourcemanager-extracttext.swift
./validation-test/compiler_crashers_fixed/26623-std-function-func-swift-constraints-solution-computesubstitutions.swift
./validation-test/compiler_crashers_fixed/00096-swift-clangmoduleunit-getadaptermodule.swift
./validation-test/compiler_crashers_fixed/26214-swift-conformancelookuptable-getconformance.swift
./validation-test/compiler_crashers_fixed/25377-swift-declname-printpretty.swift
./validation-test/compiler_crashers_fixed/00230-llvm-foldingset-swift-structtype-nodeequals.swift
./validation-test/compiler_crashers_fixed/26545-swift-lexer-lexidentifier.swift
./validation-test/compiler_crashers_fixed/28445-gp-getouterparameters-proto-getdeclcontext-getgenericparamsofcontext-failed.swift
./validation-test/compiler_crashers_fixed/02170-swift-inouttype-get.swift
./validation-test/compiler_crashers_fixed/28496-args-size-fnref-getnumargumentsforfullapply-partial-application-was-throwing.swift
./validation-test/compiler_crashers_fixed/28730-unreachable-executed-at-swift-lib-ast-astcontext-cpp-1229.swift
./validation-test/compiler_crashers_fixed/27724-swift-constraints-constraintgraph-change-undo.swift
./validation-test/compiler_crashers_fixed/27035-swift-constraints-constraintgraph-unbindtypevariable.swift
./validation-test/compiler_crashers_fixed/28615-swift-constraints-constraintgraph-bindtypevariable-swift-typevariabletype-swift.swift
./validation-test/compiler_crashers_fixed/01234-swift-parser-parseexprpostfix.swift
./validation-test/compiler_crashers_fixed/00862-swift-tupletype-get.swift
./validation-test/compiler_crashers_fixed/01249-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/27538-swift-typebase-getanyoptionalobjecttype.swift
./validation-test/compiler_crashers_fixed/28158-swift-parser-diagnose.swift
./validation-test/compiler_crashers_fixed/00846-swift-typebase-getanyoptionalobjecttype.swift
./validation-test/compiler_crashers_fixed/27786-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/26217-swift-typebase-gettypevariables.swift
./validation-test/compiler_crashers_fixed/25971-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/25593-swift-inouttype-get.swift
./validation-test/compiler_crashers_fixed/28634-anonymous-namespace-verifier-verifychecked-swift-type-llvm-smallptrset-swift-arc.swift
./validation-test/compiler_crashers_fixed/28763-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/26738-swift-inflightdiagnostic-fixitreplacechars.swift
./validation-test/compiler_crashers_fixed/26593-void.swift
./validation-test/compiler_crashers_fixed/26795-swift-typechecker-validatetype.swift
./validation-test/compiler_crashers_fixed/27144-swift-typebase-getsuperclass.swift
./validation-test/compiler_crashers_fixed/01431-swift-unboundgenerictype-get.swift
./validation-test/compiler_crashers_fixed/00493-swift-type-transform.swift
./validation-test/compiler_crashers_fixed/28360-swift-archetypebuilder-maptypeoutofcontext.swift
./validation-test/compiler_crashers_fixed/00101-swift-constraints-constraintsystem-applysolution.swift
./validation-test/compiler_crashers_fixed/26850-swift-existentialmetatypetype-get.swift
./validation-test/compiler_crashers_fixed/01440-swift-parser-parsetoken.swift
./validation-test/compiler_crashers_fixed/01802-swift-astvisitor.swift
./validation-test/compiler_crashers_fixed/28710-swift-typebase-getdesugaredtype.swift
./validation-test/compiler_crashers_fixed/25458-swift-archetypetype-getnestedtype.swift
./validation-test/compiler_crashers_fixed/26828-llvm-foldingset-swift-tupletype-nodeequals.swift
./validation-test/compiler_crashers_fixed/25392-swift-patternbindingdecl-setpattern.swift
./validation-test/compiler_crashers_fixed/26661-swift-typechecker-coercepatterntotype.swift
./validation-test/compiler_crashers_fixed/00079-llvm-ondiskchainedhashtable-swift-modulefile-decltableinfo-find.swift
./validation-test/compiler_crashers_fixed/26553-swift-parser-parseexprpostfix.swift
./validation-test/compiler_crashers_fixed/00346-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/26390-swift-mangle-mangler-mangledeclname.swift
./validation-test/compiler_crashers_fixed/02116-swift-modulefile-maybereadgenericparams.swift
./validation-test/compiler_crashers_fixed/27549-swift-namelookup-findlocalval-visitbracestmt.swift
./validation-test/compiler_crashers_fixed/28446-activediagnostic-already-have-an-active-diagnostic-failed.swift
./validation-test/compiler_crashers_fixed/00367-llvm-errs.swift
./validation-test/compiler_crashers_fixed/28240-swift-archetypebuilder-addrequirement.swift
./validation-test/compiler_crashers_fixed/26334-swift-arrayslicetype-get.swift
./validation-test/compiler_crashers_fixed/25672-swift-astcontext-allocate.swift
./validation-test/compiler_crashers_fixed/25437-swift-typechecker-resolveidentifiertype.swift
./validation-test/compiler_crashers_fixed/00152-swift-parser-parsetypeidentifier.swift
./validation-test/compiler_crashers_fixed/26065-swift-tuplepattern-create.swift
./validation-test/compiler_crashers_fixed/01418-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/28472-swift-modulefile-getdecl-llvm-pointerembeddedint-unsigned-int-31-llvm-optional-s.swift
./validation-test/compiler_crashers_fixed/25537-swift-parser-parsegenericparameters.swift
./validation-test/compiler_crashers_fixed/00671-swift-constraints-solution-computesubstitutions.swift
./validation-test/compiler_crashers_fixed/25655-void.swift
./validation-test/compiler_crashers_fixed/26001-swift-astcontext-astcontext.swift
./validation-test/compiler_crashers_fixed/01853-swift-lexer-lexidentifier.swift
./validation-test/compiler_crashers_fixed/28031-swift-clangimporter-lookupvalue.swift
./validation-test/compiler_crashers_fixed/01622-swift-modulefile-maybereadpattern.swift
./validation-test/compiler_crashers_fixed/00183-swift-inflightdiagnostic-fixitreplacechars.swift
./validation-test/compiler_crashers_fixed/00614-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/00769-swift-modulefile-getdecl.swift
./validation-test/compiler_crashers_fixed/02191-swift-streamprinter-printtext.swift
./validation-test/compiler_crashers_fixed/01791-swift-typedecl-getdeclaredtype.swift
./validation-test/compiler_crashers_fixed/01796-swift-modulefile-getdecl.swift
./validation-test/compiler_crashers_fixed/26337-swift-modulefile-maybereadgenericparams.swift
./validation-test/compiler_crashers_fixed/25473-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/26803-swift-parser-skipsingle.swift
./validation-test/compiler_crashers_fixed/27325-swift-maybeaddaccessorstovariable.swift
./validation-test/compiler_crashers_fixed/28658-result-case-not-implemented.swift
./validation-test/compiler_crashers_fixed/02108-swift-type-transform.swift
./validation-test/compiler_crashers_fixed/26993-swift-valuedecl-settype.swift
./validation-test/compiler_crashers_fixed/00622-swift-constraints-constraintsystem-getfixedtyperecursive.swift
./validation-test/compiler_crashers_fixed/27811-swift-constraints-solution-computesubstitutions.swift
./validation-test/compiler_crashers_fixed/00201-swift-parser-parsetoken.swift
./validation-test/compiler_crashers_fixed/26752-swift-typeloc-iserror.swift
./validation-test/compiler_crashers_fixed/01673-swift-constraints-constraintsystem-opengeneric.swift
./validation-test/compiler_crashers_fixed/01502-swift-modulefile-gettype.swift
./validation-test/compiler_crashers_fixed/02219-llvm-ondiskchainedhashtable-swift-modulefile-decltableinfo-find.swift
./validation-test/compiler_crashers_fixed/01746-llvm-smallvectorimpl-swift-diagnosticargument-operator.swift
./validation-test/compiler_crashers_fixed/01665-llvm-foldingset-swift-enumtype-nodeequals.swift
./validation-test/compiler_crashers_fixed/25691-bool.swift
./validation-test/compiler_crashers_fixed/27667-swift-modulefile-getdecl.swift
./validation-test/compiler_crashers_fixed/27685-swift-pattern-foreachvariable.swift
./validation-test/compiler_crashers_fixed/25747-swift-genericsignature-get.swift
./validation-test/compiler_crashers_fixed/25800-swift-structtype-get.swift
./validation-test/compiler_crashers_fixed/26373-swift-parser-skipsingle.swift
./validation-test/compiler_crashers_fixed/01254-swift-constraints-constraintsystem-diagnosefailurefromconstraints.swift
./validation-test/compiler_crashers_fixed/27790-llvm-ondiskchainedhashtable-swift-modulefile-decltableinfo-find.swift
./validation-test/compiler_crashers_fixed/28491-result-case-not-implemented.swift
./validation-test/compiler_crashers_fixed/27112-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/26692-swift-astcontext-getloadedmodule.swift
./validation-test/compiler_crashers_fixed/27627-swift-typechecker-checkdeclarationavailability.swift
./validation-test/compiler_crashers_fixed/02239-swift-parser-consumetoken.swift
./validation-test/compiler_crashers_fixed/02186-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/00807-swift-archetypebuilder-resolvearchetype.swift
./validation-test/compiler_crashers_fixed/01316-swift-typechecker-validatetype.swift
./validation-test/compiler_crashers_fixed/00651-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/01107-std-function-func-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/28527-e-gettype-isassignabletype-setting-access-kind-on-non-l-value.swift
./validation-test/compiler_crashers_fixed/25790-swift-genericparamlist-addnestedarchetypes.swift
./validation-test/compiler_crashers_fixed/01962-swift-genericfunctiontype-get.swift
./validation-test/compiler_crashers_fixed/26258-swift-constraints-constraintsystem-matchtypes.swift
./validation-test/compiler_crashers_fixed/27061-swift-archetypebuilder-getallarchetypes.swift
./validation-test/compiler_crashers_fixed/27579-vtable.swift
./validation-test/compiler_crashers_fixed/27539-swift-parser-parsetoken.swift
./validation-test/compiler_crashers_fixed/28644-swift-functiontype-get-swift-type-swift-type-swift-anyfunctiontype-extinfo-const.swift
./validation-test/compiler_crashers_fixed/00724-swift-typechecker-coercepatterntotype.swift
./validation-test/compiler_crashers_fixed/01729-swift-parser-parsetoken.swift
./validation-test/compiler_crashers_fixed/02154-swift-sourcefile-getcache.swift
./validation-test/compiler_crashers_fixed/00162-swift-type-transform.swift
./validation-test/compiler_crashers_fixed/28729-archetype-bad-generic-context-nesting.swift
./validation-test/compiler_crashers_fixed/26956-swift-constructordecl-constructordecl.swift
./validation-test/compiler_crashers_fixed/28369-swift-decl-walk.swift
./validation-test/compiler_crashers_fixed/28590-exprtypes-e-isequal-e-gettype-expected-type-in-map-to-be-the-same-type-in-expres.swift
./validation-test/compiler_crashers_fixed/01352-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/27322-swift-constraints-constraintgraph-addconstraint.swift
./validation-test/compiler_crashers_fixed/28419-swift-silmodule-constructsil.swift
./validation-test/compiler_crashers_fixed/01090-swift-parser-parsebraceitems.swift
./validation-test/compiler_crashers_fixed/28363-swift-expr-walk.swift
./validation-test/compiler_crashers_fixed/01760-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/01292-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/27345-swift-modulefile-maybereadpattern.swift
./validation-test/compiler_crashers_fixed/26099-swift-constraints-constraintsystem-getconstraintlocator.swift
./validation-test/compiler_crashers_fixed/00890-swift-completegenerictyperesolver-resolvedependentmembertype.swift
./validation-test/compiler_crashers_fixed/28526-objectty-is-lvaluetype-objectty-is-inouttype-cannot-have-inout-or-lvalue-wrapped.swift
./validation-test/compiler_crashers_fixed/27069-swift-tupletype-get.swift
./validation-test/compiler_crashers_fixed/25482-void.swift
./validation-test/compiler_crashers_fixed/01033-swift-declcontext-lookupqualified.swift
./validation-test/compiler_crashers_fixed/01557-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/00130-swift-lexer-leximpl.swift
./validation-test/compiler_crashers_fixed/02067-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/28845-llvm-optional-swift-type-llvm-function-ref-llvm-optional-swift-type-swift-typeba.swift
./validation-test/compiler_crashers_fixed/00212-swift-constraints-solution-simplifytype.swift
./validation-test/compiler_crashers_fixed/27857-vtable.swift
./validation-test/compiler_crashers_fixed/00025-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/26415-swift-constraints-constraintgraphscope-constraintgraphscope.swift
./validation-test/compiler_crashers_fixed/01079-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/27965-llvm-foldingset-swift-tupletype-nodeequals.swift
./validation-test/compiler_crashers_fixed/01889-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/28817-swift-typebase-getdesugaredtype.swift
./validation-test/compiler_crashers_fixed/27720-swift-valuedecl-overwritetype.swift
./validation-test/compiler_crashers_fixed/26312-swift-typechecker-resolvesuperclass.swift
./validation-test/compiler_crashers_fixed/01954-swift-constraints-constraintsystem-assignfixedtype.swift
./validation-test/compiler_crashers_fixed/28291-swift-constraints-constraintsystem-comparesolutions.swift
./validation-test/compiler_crashers_fixed/00875-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/26400-swift-tupletype-get.swift
./validation-test/compiler_crashers_fixed/26594-swift-parser-parsetoken.swift
./validation-test/compiler_crashers_fixed/01634-swift-typechecker-checksubstitutions.swift
./validation-test/compiler_crashers_fixed/28175-swift-parser-parsedeclextension.swift
./validation-test/compiler_crashers_fixed/01883-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/27754-swift-typechecker-resolvetypeincontext.swift
./validation-test/compiler_crashers_fixed/01040-swift-constraints-constraintsystem-simplifytype.swift
./validation-test/compiler_crashers_fixed/28656-unreachable-executed-at-swift-lib-ast-type-cpp-1137.swift
./validation-test/compiler_crashers_fixed/01084-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/28571-hasinterfacetype-no-interface-type-was-set.swift
./validation-test/compiler_crashers_fixed/27555-swift-constraints-constraintgraph-lookupnode.swift
./validation-test/compiler_crashers_fixed/26713-swift-removeshadoweddecls.swift
./validation-test/compiler_crashers_fixed/00914-swift-modulefile-getdecl.swift
./validation-test/compiler_crashers_fixed/25937-swift-valuedecl.swift
./validation-test/compiler_crashers_fixed/26195-swift-tuplepattern-create.swift
./validation-test/compiler_crashers_fixed/01677-swift-dependentmembertype-get.swift
./validation-test/compiler_crashers_fixed/01298-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/01757-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/27416-swift-archetypebuilder-potentialarchetype-gettype.swift
./validation-test/compiler_crashers_fixed/00486-llvm-smallvectorbase-grow-pod.swift
./validation-test/compiler_crashers_fixed/26453-swift-astcontext-getloadedmodule.swift
./validation-test/compiler_crashers_fixed/26862-swift-typechecker-resolvepattern.swift
./validation-test/compiler_crashers_fixed/00512-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/27758-std-function-func-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/28707-false-encountered-error-in-diagnostic-text.swift
./validation-test/compiler_crashers_fixed/28453-found-interfacetoarchetypemap-end-missing-generic-parameter-failed.swift
./validation-test/compiler_crashers_fixed/01212-swift-declname-printpretty.swift
./validation-test/compiler_crashers_fixed/25838-swift-diagnosticengine-emitdiagnostic.swift
./validation-test/compiler_crashers_fixed/28603-argumentlabels-size-1.swift
./validation-test/compiler_crashers_fixed/28494-conforms-type-does-not-conform-to-protocol.swift
./validation-test/compiler_crashers_fixed/01394-swift-typechecker-typecheckexpression.swift
./validation-test/compiler_crashers_fixed/27595-swift-parser-parsedeclvar.swift
./validation-test/compiler_crashers_fixed/28589-swift-type-transform-llvm-function-ref-swift-type-swift-type-const.swift
./validation-test/compiler_crashers_fixed/28087-swift-genericsignature-profile.swift
./validation-test/compiler_crashers_fixed/25689-swift-patternbindingdecl-getpatternentryindexforvardecl.swift
./validation-test/compiler_crashers_fixed/27768-swift-typechecker-lookupunqualified.swift
./validation-test/compiler_crashers_fixed/02033-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/01785-swift-scopeinfo-addtoscope.swift
./validation-test/compiler_crashers_fixed/01151-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/02122-swift-modulefile-maybereadgenericparams.swift
./validation-test/compiler_crashers_fixed/28089-extractsimplefield.swift
./validation-test/compiler_crashers_fixed/27122-llvm-ondiskchainedhashtable-swift-modulefile-decltableinfo-find.swift
./validation-test/compiler_crashers_fixed/26644-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/00169-swift-typebase-operator.swift
./validation-test/compiler_crashers_fixed/28843-startofcontrol-tok-getloc.swift
./validation-test/compiler_crashers_fixed/25836-resolveidenttypecomponent.swift
./validation-test/compiler_crashers_fixed/27152-swift-lexer-getlocforendoftoken.swift
./validation-test/compiler_crashers_fixed/27883-swift-archetypebuilder-addconformancerequirement.swift
./validation-test/compiler_crashers_fixed/27719-std-function-func-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/27830-swift-constraints-constraintsystem-simplifytype.swift
./validation-test/compiler_crashers_fixed/25763-std-function-func.swift
./validation-test/compiler_crashers_fixed/02102-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/01069-swift-nominaltypedecl-getprotocols.swift
./validation-test/compiler_crashers_fixed/01142-std-function-func-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/00632-swift-constraints-constraintsystem-opengeneric.swift
./validation-test/compiler_crashers_fixed/26228-void.swift
./validation-test/compiler_crashers_fixed/01302-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/00849-swift-type-transform.swift
./validation-test/compiler_crashers_fixed/27872-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/28244-swift-valuedecl-isinstancemember.swift
./validation-test/compiler_crashers_fixed/28008-swift-builtinunit-lookupcache-lookupvalue.swift
./validation-test/compiler_crashers_fixed/01626-swift-constraints-solution-solution.swift
./validation-test/compiler_crashers_fixed/00691-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/26610-swift-parser-parsedecl.swift
./validation-test/compiler_crashers_fixed/27405-swift-constraints-constraintsystem-simplifyconstraint.swift
./validation-test/compiler_crashers_fixed/00772-swift-substitutedtype-get.swift
./validation-test/compiler_crashers_fixed/26849-swift-constraints-constraintsystem-generateconstraints.swift
./validation-test/compiler_crashers_fixed/25803-swift-constructordecl-setbodyparams.swift
./validation-test/compiler_crashers_fixed/02009-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/26558-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/27451-swift-parser-parsedeclstruct.swift
./validation-test/compiler_crashers_fixed/26157-resolveidenttypecomponent.swift
./validation-test/compiler_crashers_fixed/26007-swift-constraints-solution-computesubstitutions.swift
./validation-test/compiler_crashers_fixed/27059-swift-optionaltype-get.swift
./validation-test/compiler_crashers_fixed/02131-swift-parser-parsedeclclass.swift
./validation-test/compiler_crashers_fixed/02251-swift-lexer-getlocforendoftoken.swift
./validation-test/compiler_crashers_fixed/01227-swift-lexer-lexidentifier.swift
./validation-test/compiler_crashers_fixed/01726-getmemberforbasetype.swift
./validation-test/compiler_crashers_fixed/01358-swift-lexer-leximpl.swift
./validation-test/compiler_crashers_fixed/27543-swift-typechecker-checkgenericarguments.swift
./validation-test/compiler_crashers_fixed/01026-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/25592-swift-parser-parsetoken.swift
./validation-test/compiler_crashers_fixed/01109-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/01386-swift-substitutedtype-get.swift
./validation-test/compiler_crashers_fixed/01454-swift-typechecker-checksubstitutions.swift
./validation-test/compiler_crashers_fixed/01053-swift-inouttype-get.swift
./validation-test/compiler_crashers_fixed/26305-swift-diagnosticengine-emitdiagnostic.swift
./validation-test/compiler_crashers_fixed/28040-swift-genericparamlist-addnestedarchetypes.swift
./validation-test/compiler_crashers_fixed/26132-swift-boundgenerictype-get.swift
./validation-test/compiler_crashers_fixed/25983-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/27743-swift-constraints-constraintsystem-solvesimplified.swift
./validation-test/compiler_crashers_fixed/27675-vtable.swift
./validation-test/compiler_crashers_fixed/27167-swift-valuedecl-overwritetype.swift
./validation-test/compiler_crashers_fixed/25980-llvm-ondiskchainedhashtable-swift-modulefile-decltableinfo-find.swift
./validation-test/compiler_crashers_fixed/26375-vtable.swift
./validation-test/compiler_crashers_fixed/27943-swift-astcontext-getinheritedconformance.swift
./validation-test/compiler_crashers_fixed/28802-constrainttype-missing-constraint-type.swift
./validation-test/compiler_crashers_fixed/27571-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/00921-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/26330-firsttarget.swift
./validation-test/compiler_crashers_fixed/28023-swift-typechecker-diagnoseexplicitunavailability.swift
./validation-test/compiler_crashers_fixed/27319-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/00126-swift-generictypetoarchetyperesolver-resolvegenerictypeparamtype.swift
./validation-test/compiler_crashers_fixed/00408-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/01788-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/28336-swift-archetypebuilder-addrequirement.swift
./validation-test/compiler_crashers_fixed/28115-swift-patternbindingdecl-create.swift
./validation-test/compiler_crashers_fixed/00609-llvm-prettystacktraceentry-prettystacktraceentry.swift
./validation-test/compiler_crashers_fixed/25793-swift-typechecker-checkunsupportedprotocoltype.swift
./validation-test/compiler_crashers_fixed/00374-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/02103-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/01806-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/01638-swift-genericfunctiontype-get.swift
./validation-test/compiler_crashers_fixed/25634-swift-parser-parsetoken.swift
./validation-test/compiler_crashers_fixed/26105-std-function-func-swift-constraints-constraintsystem-simplifytype.swift
./validation-test/compiler_crashers_fixed/02104-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/01391-swift-typechecker-callwitness.swift
./validation-test/compiler_crashers_fixed/27252-swift-moduledecl-lookupconformance.swift
./validation-test/compiler_crashers_fixed/26606-swift-genericsignature-get.swift
./validation-test/compiler_crashers_fixed/26031-swift-nominaltypedecl-prepareextensions.swift
./validation-test/compiler_crashers_fixed/25728-swift-modulefile-maybereadgenericparams.swift
./validation-test/compiler_crashers_fixed/01392-swift-modulefile-lookupvalue.swift
./validation-test/compiler_crashers_fixed/26034-swift-parser-parseexprcallsuffix.swift
./validation-test/compiler_crashers_fixed/27477-swift-archetypebuilder-potentialarchetype-getarchetypeanchor.swift
./validation-test/compiler_crashers_fixed/01032-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/26026-swift-archetypebuilder-finalize.swift
./validation-test/compiler_crashers_fixed/01008-swift-modulefile-maybereadgenericparams.swift
./validation-test/compiler_crashers_fixed/00981-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/00305-swift-constraints-constraintsystem-matchtypes.swift
./validation-test/compiler_crashers_fixed/01006-swift-modulefile-resolvecrossreference.swift
./validation-test/compiler_crashers_fixed/28473-typevariables-impl-getgraphindex-typevar-type-variable-mismatch.swift
./validation-test/compiler_crashers_fixed/28807-parentequiv-conformsto-count-proto-0-no-conformance-requirement.swift
./validation-test/compiler_crashers_fixed/26246-llvm-raw-ostream-setbuffered.swift
./validation-test/compiler_crashers_fixed/01003-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/28075-swift-lexer-lexstringliteral.swift
./validation-test/compiler_crashers_fixed/01270-swift-lexer-lexidentifier.swift
./validation-test/compiler_crashers_fixed/26900-swift-typechecker-overapproximateosversionsatlocation.swift
./validation-test/compiler_crashers_fixed/00664-swift-pattern-operator.swift
./validation-test/compiler_crashers_fixed/26577-swift-abstractclosureexpr-setparams.swift
./validation-test/compiler_crashers_fixed/01888-vtable.swift
./validation-test/compiler_crashers_fixed/28755-getkind-requirementkind-layout.swift
./validation-test/compiler_crashers_fixed/28114-swift-tuplepattern-create.swift
./validation-test/compiler_crashers_fixed/25342-swift-sourcemanager-getbytedistance.swift
./validation-test/compiler_crashers_fixed/27577-swift-funcdecl-setdeserializedsignature.swift
./validation-test/compiler_crashers_fixed/28261-swift-iterativetypechecker-satisfy.swift
./validation-test/compiler_crashers_fixed/01085-swift-declcontext-lookupqualified.swift
./validation-test/compiler_crashers_fixed/26517-swift-type-transform.swift
./validation-test/compiler_crashers_fixed/28745-ty-getnominalorboundgenericnominal-ty-is-dynamicselftype-ty-isexistentialtype-ty.swift
./validation-test/compiler_crashers_fixed/28855-swift-genericsignaturebuilder-addrequirement-swift-requirementrepr-const-swift-g.swift
./validation-test/compiler_crashers_fixed/25464-swift-typechecker-typecheckexpression.swift
./validation-test/compiler_crashers_fixed/28484-isa-x-val-cast-ty-argument-of-incompatible-type.swift
./validation-test/compiler_crashers_fixed/25735-swift-modulefile-readmembers.swift
./validation-test/compiler_crashers_fixed/28621-typevariables-impl-getgraphindex-typevar-type-variable-mismatch.swift
./validation-test/compiler_crashers_fixed/27863-swift-serializedmoduleloader-loadextensions.swift
./validation-test/compiler_crashers_fixed/00295-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/27424-swift-genericparamlist-addnestedarchetypes.swift
./validation-test/compiler_crashers_fixed/26731-swift-protocoltype-canonicalizeprotocols.swift
./validation-test/compiler_crashers_fixed/28455-type-hastypeparameter-type-haserror-not-fully-substituted-failed.swift
./validation-test/compiler_crashers_fixed/26244-swift-archetypebuilder-finalize.swift
./validation-test/compiler_crashers_fixed/28081-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/27589-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/28602-c1-size-c2-size.swift
./validation-test/compiler_crashers_fixed/25721-swift-astvisitor.swift
./validation-test/compiler_crashers_fixed/01894-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/27801-swift-clangimporter-lookupvalue.swift
./validation-test/compiler_crashers_fixed/27912-swift-classtype-get.swift
./validation-test/compiler_crashers_fixed/27304-swift-patternbindingdecl-setpattern.swift
./validation-test/compiler_crashers_fixed/26844-swift-typechecker-isdeclavailable.swift
./validation-test/compiler_crashers_fixed/00612-swift-typechecker-checksubstitutions.swift
./validation-test/compiler_crashers_fixed/25466-swift-parser-parsebraceitemlist.swift
./validation-test/compiler_crashers_fixed/01474-swift-functiontype-get.swift
./validation-test/compiler_crashers_fixed/26493-swift-protocoltype-canonicalizeprotocols.swift
./validation-test/compiler_crashers_fixed/27700-swift-modulefile-loadallmembers.swift
./validation-test/compiler_crashers_fixed/00232-swift-lookupresult-filter.swift
./validation-test/compiler_crashers_fixed/26402-swift-scopeinfo-addtoscope.swift
./validation-test/compiler_crashers_fixed/01165-swift-parser-parsetoken.swift
./validation-test/compiler_crashers_fixed/25570-std-function-func-mapsignaturetype.swift
./validation-test/compiler_crashers_fixed/00413-swift-constraints-solution-computesubstitutions.swift
./validation-test/compiler_crashers_fixed/28096-swift-parser-parsedecl.swift
./validation-test/compiler_crashers_fixed/27623-swift-boundgenerictype-get.swift
./validation-test/compiler_crashers_fixed/26799-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/01570-llvm-foldingsetnodeid-operator.swift
./validation-test/compiler_crashers_fixed/26075-swift-parser-skipsingle.swift
./validation-test/compiler_crashers_fixed/00683-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/25986-swift-constraints-constraintsystem-optimizeconstraints.swift
./validation-test/compiler_crashers_fixed/28111-swift-modulefile-readnormalconformance.swift
./validation-test/compiler_crashers_fixed/01657-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/26878-swift-conformancelookuptable-updatelookuptable.swift
./validation-test/compiler_crashers_fixed/01907-swift-generictypeparamdecl-generictypeparamdecl.swift
./validation-test/compiler_crashers_fixed/27972-swift-maybeaddaccessorstovariable.swift
./validation-test/compiler_crashers_fixed/00718-swift-parentype-get.swift
./validation-test/compiler_crashers_fixed/01286-swift-parser-parseexpridentifier.swift
./validation-test/compiler_crashers_fixed/26424-swift-lexer-getlocforendoftoken.swift
./validation-test/compiler_crashers_fixed/25366-swift-conformancelookuptable-updatelookuptable.swift
./validation-test/compiler_crashers_fixed/00496-getcallerdefaultarg.swift
./validation-test/compiler_crashers_fixed/00217-swift-associatedtypedecl-associatedtypedecl.swift
./validation-test/compiler_crashers_fixed/01908-std-function-func-mapsignaturetype.swift
./validation-test/compiler_crashers_fixed/27513-swift-typeloc-iserror.swift
./validation-test/compiler_crashers_fixed/00358-swift-constraints-constraintsystem-lookthroughimplicitlyunwrappedoptionaltype.swift
./validation-test/compiler_crashers_fixed/26118-swift-lexer-leximpl.swift
./validation-test/compiler_crashers_fixed/27503-swift-conformancelookuptable-expandimpliedconformances.swift
./validation-test/compiler_crashers_fixed/26111-swift-modulefile-maybereadpattern.swift
./validation-test/compiler_crashers_fixed/26262-swift-constraints-constraintsystem-addtypevariableconstraintstoworklist.swift
./validation-test/compiler_crashers_fixed/28286-swift-typechecker-applyunboundgenericarguments.swift
./validation-test/compiler_crashers_fixed/27313-swift-genericfunctiontype-get.swift
./validation-test/compiler_crashers_fixed/01748-swift-typebase-getanyoptionalobjecttype.swift
./validation-test/compiler_crashers_fixed/28100-swift-tupletype-get.swift
./validation-test/compiler_crashers_fixed/25387-swift-typebase-getsuperclass.swift
./validation-test/compiler_crashers_fixed/25591-std-function-func-swift-archetypebuilder-maptypeintocontext.swift
./validation-test/compiler_crashers_fixed/27206-llvm-foldingset-swift-classtype-nodeequals.swift
./validation-test/compiler_crashers_fixed/27899-swift-unboundgenerictype-get.swift
./validation-test/compiler_crashers_fixed/02155-swift-optional-swift-diagnostic-operator.swift
./validation-test/compiler_crashers_fixed/28332-swift-archetypebuilder-getgenericsignature.swift
./validation-test/compiler_crashers_fixed/26488-swift-expr-walk.swift
./validation-test/compiler_crashers_fixed/28625-destoptionals-size-destextraoptionals-srcoptionals-size.swift
./validation-test/compiler_crashers_fixed/28242-swift-constraints-constraintsystem-simplify.swift
./validation-test/compiler_crashers_fixed/25431-swift-prettystacktracetyperepr-print.swift
./validation-test/compiler_crashers_fixed/01606-swift-constraints-constraintsystem-getfixedtyperecursive.swift
./validation-test/compiler_crashers_fixed/00029-class-with-anyobject-type-constraint.swift
./validation-test/compiler_crashers_fixed/28109-swift-constraints-constraintgraph-removeconstraint.swift
./validation-test/compiler_crashers_fixed/01710-swift-typechecker-callwitness.swift
./validation-test/compiler_crashers_fixed/01833-swift-clangmoduleunit-getimportedmodules.swift
./validation-test/compiler_crashers_fixed/25486-llvm-foldingset-swift-tupletype-nodeequals.swift
./validation-test/compiler_crashers_fixed/26927-swift-modulefile-maybereadgenericparams.swift
./validation-test/compiler_crashers_fixed/25359-swift-genericparamlist-deriveallarchetypes.swift
./validation-test/compiler_crashers_fixed/28518-anonymous-namespace-verifier-walktoexprpost-swift-expr.swift
./validation-test/compiler_crashers_fixed/28423-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/01044-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/25371-llvm-raw-fd-ostream-write-impl.swift
./validation-test/compiler_crashers_fixed/25926-swift-parser-isstartofdecl.swift
./validation-test/compiler_crashers_fixed/27812-swift-archetypebuilder-addgenericsignature.swift
./validation-test/compiler_crashers_fixed/25128-swift-type-transform.swift
./validation-test/compiler_crashers_fixed/28475-swift-typechecker-validatedecl-swift-valuedecl-bool.swift
./validation-test/compiler_crashers_fixed/02061-swift-constraints-constraintgraph-gatherconstraints.swift
./validation-test/compiler_crashers_fixed/26318-swift-substitutedtype-get.swift
./validation-test/compiler_crashers_fixed/26234-swift-sourcemanager-extracttext.swift
./validation-test/compiler_crashers_fixed/28717-result-case-not-implemented.swift
./validation-test/compiler_crashers_fixed/27973-swift-typechecker-substituteinputsugartypeforresult.swift
./validation-test/compiler_crashers_fixed/25572-swift-type-print.swift
./validation-test/compiler_crashers_fixed/01209-llvm-errs.swift
./validation-test/compiler_crashers_fixed/27887-swift-protocolcompositiontyperepr-create.swift
./validation-test/compiler_crashers_fixed/26197-load-method-type.swift
./validation-test/compiler_crashers_fixed/25762-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/01970-void.swift
./validation-test/compiler_crashers_fixed/28107-swift-typechecker-checkconformance.swift
./validation-test/compiler_crashers_fixed/28249-swift-typechecker-validategenericfuncsignature.swift
./validation-test/compiler_crashers_fixed/01276-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/27618-swift-modulefile-getimportedmodules.swift
./validation-test/compiler_crashers_fixed/26203-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/26242-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/28609-unreachable-executed-at-swift-lib-sema-csapply-cpp-5859.swift
./validation-test/compiler_crashers_fixed/28402-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/02151-swift-tupletype-get.swift
./validation-test/compiler_crashers_fixed/27600-swift-constraints-constraintsystem-recordopenedtypes.swift
./validation-test/compiler_crashers_fixed/28614-args-size-fnref-getnumargumentsforfullapply-partial-application-was-throwing.swift
./validation-test/compiler_crashers_fixed/01131-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/00469-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/27117-swift-clangimporter-implementation-importdeclimpl.swift
./validation-test/compiler_crashers_fixed/27725-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/01878-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/02208-swift-modulefile-configurestorage.swift
./validation-test/compiler_crashers_fixed/26843-std-function-func-mapsignaturetype.swift
./validation-test/compiler_crashers_fixed/25505-swift-constraints-constraintsystem-salvage.swift
./validation-test/compiler_crashers_fixed/25358-llvm-foldingset-swift-classtype-nodeequals.swift
./validation-test/compiler_crashers_fixed/01936-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/27018-swift-conformancelookuptable-getallprotocols.swift
./validation-test/compiler_crashers_fixed/25741-vtable.swift
./validation-test/compiler_crashers_fixed/27286-swift-extensiondecl-getmembers.swift
./validation-test/compiler_crashers_fixed/28189-swift-valuedecl-settype.swift
./validation-test/compiler_crashers_fixed/00175-swift-parser-parseexprlist.swift
./validation-test/compiler_crashers_fixed/27832-swift-typechecker-resolvetypeincontext.swift
./validation-test/compiler_crashers_fixed/28462-segfault-0xcdc361-0xd051ef-0xcdc361-0xd051ef.swift
./validation-test/compiler_crashers_fixed/28586-objectty-is-lvaluetype-objectty-is-inouttype-cannot-have-inout-or-lvalue-wrapped.swift
./validation-test/compiler_crashers_fixed/28180-rawrepresentable-extension-with-initializer.swift
./validation-test/compiler_crashers_fixed/26582-swift-modulefile-gettype.swift
./validation-test/compiler_crashers_fixed/28661-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/25886-swift-astcontext-getidentifier.swift
./validation-test/compiler_crashers_fixed/27718-swift-parser-parseidentifier.swift
./validation-test/compiler_crashers_fixed/25791-swift-modulefile-getdeclcontext.swift
./validation-test/compiler_crashers_fixed/01405-swift-clangimporter-implementation-finishloadingclangmodule.swift
./validation-test/compiler_crashers_fixed/01385-swift-typedecl-getdeclaredtype.swift
./validation-test/compiler_crashers_fixed/26780-swift-parser-parsestmt.swift
./validation-test/compiler_crashers_fixed/26201-swift-astcontext-allocate.swift
./validation-test/compiler_crashers_fixed/27079-swift-clangmoduleunit-lookupvalue.swift
./validation-test/compiler_crashers_fixed/00392-llvm-prettystacktraceentry-prettystacktraceentry.swift
./validation-test/compiler_crashers_fixed/28172-swift-parser-parsedeclstruct.swift
./validation-test/compiler_crashers_fixed/27305-swift-markasobjc.swift
./validation-test/compiler_crashers_fixed/01246-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/27927-swift-modulefile-maybereadpattern.swift
./validation-test/compiler_crashers_fixed/01535-swift-constraints-constraintgraph-removeconstraint.swift
./validation-test/compiler_crashers_fixed/26682-swift-constraints-constraint-constraint.swift
./validation-test/compiler_crashers_fixed/26407-llvm-smallvectorbase-grow-pod.swift
./validation-test/compiler_crashers_fixed/26596-swift-removeshadoweddecls.swift
./validation-test/compiler_crashers_fixed/01375-clang-declvisitor-base-clang-declvisitor-make-const-ptr.swift
./validation-test/compiler_crashers_fixed/27281-swift-constraints-simplifylocator.swift
./validation-test/compiler_crashers_fixed/25719-swift-typechecker-getinterfacetypefrominternaltype.swift
./validation-test/compiler_crashers_fixed/26218-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/26942-swift-nominaltypedecl-computeinterfacetype.swift
./validation-test/compiler_crashers_fixed/28366-swift-archetypebuilder-finalize.swift
./validation-test/compiler_crashers_fixed/28207-swift-dependentgenerictyperesolver-resolveselfassociatedtype.swift
./validation-test/compiler_crashers_fixed/00023-getcallerdefaultarg.swift
./validation-test/compiler_crashers_fixed/26384-swift-lexer-getlocforendoftoken.swift
./validation-test/compiler_crashers_fixed/00462-swift-constraints-constraintsystem-getfixedtyperecursive.swift
./validation-test/compiler_crashers_fixed/01373-swift-valuedecl-getinterfacetype.swift
./validation-test/compiler_crashers_fixed/25992-swift-typebase-getsuperclass.swift
./validation-test/compiler_crashers_fixed/27072-swift-createimplicitconstructor.swift
./validation-test/compiler_crashers_fixed/27594-swift-getbuiltinvaluedecl.swift
./validation-test/compiler_crashers_fixed/27299-swift-enumtype-get.swift
./validation-test/compiler_crashers_fixed/28666-conformingreplacementtype-is-substitutabletype-conformingreplacementtype-is-depe.swift
./validation-test/compiler_crashers_fixed/01176-swift-constraints-constraintsystem-matchtypes.swift
./validation-test/compiler_crashers_fixed/27900-swift-constraints-constraintsystem-assignfixedtype.swift
./validation-test/compiler_crashers_fixed/01300-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/00681-swift-declcontext-lookupqualified.swift
./validation-test/compiler_crashers_fixed/02022-swift-clangmoduleunit-getimportedmodules.swift
./validation-test/compiler_crashers_fixed/28706-conformance-failed-to-find-pas-conformance-to-known-protocol.swift
./validation-test/compiler_crashers_fixed/27471-swift-unqualifiedlookup-unqualifiedlookup.swift
./validation-test/compiler_crashers_fixed/00586-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/25782-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/27235-swift-lexer-getlocforendoftoken.swift
./validation-test/compiler_crashers_fixed/26454-swift-typebase-isequal.swift
./validation-test/compiler_crashers_fixed/27981-std-function-func.swift
./validation-test/compiler_crashers_fixed/00114-swift-constraints-solution-computesubstitutions.swift
./validation-test/compiler_crashers_fixed/28029-swift-constraints-constraintsystem-performmemberlookup.swift
./validation-test/compiler_crashers_fixed/01876-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/01080-swift-type-transform.swift
./validation-test/compiler_crashers_fixed/00017-llvm-foldingset-llvm-attributesetnode-nodeequals.swift
./validation-test/compiler_crashers_fixed/00837-swift-clangmoduleunit-getadaptermodule.swift
./validation-test/compiler_crashers_fixed/27321-swift-createimplicitconstructor.swift
./validation-test/compiler_crashers_fixed/01513-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/27528-swift-constraints-constraintsystem-solve.swift
./validation-test/compiler_crashers_fixed/27212-swift-removeshadoweddecls.swift
./validation-test/compiler_crashers_fixed/27573-swift-modulefile-maybereadpattern.swift
./validation-test/compiler_crashers_fixed/26084-swift-typebase-getsuperclass.swift
./validation-test/compiler_crashers_fixed/01408-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/27169-swift-typechecker-validategenericfuncsignature.swift
./validation-test/compiler_crashers_fixed/01719-swift-typebase-getanyoptionalobjecttype.swift
./validation-test/compiler_crashers_fixed/02165-swift-diagnosticengine-diagnose.swift
./validation-test/compiler_crashers_fixed/28173-swift-typebase-isspecialized.swift
./validation-test/compiler_crashers_fixed/25933-swift-typechecker-resolveidentifiertype.swift
./validation-test/compiler_crashers_fixed/26753-swift-parser-parsegenericwhereclause.swift
./validation-test/compiler_crashers_fixed/00690-swift-declname-declname.swift
./validation-test/compiler_crashers_fixed/26308-swift-genericsignature-get.swift
./validation-test/compiler_crashers_fixed/01933-swift-constraints-constraintsystem-solve.swift
./validation-test/compiler_crashers_fixed/28588-unreachable-executed-at-swift-lib-sema-csapply-cpp-5770.swift
./validation-test/compiler_crashers_fixed/27009-swift-abstractclosureexpr-setparams.swift
./validation-test/compiler_crashers_fixed/26455-swift-parser-parsedecl.swift
./validation-test/compiler_crashers_fixed/26171-swift-astcontext-allocate.swift
./validation-test/compiler_crashers_fixed/27508-swift-typebase-getdesugaredtype.swift
./validation-test/compiler_crashers_fixed/27904-swift-funcdecl-isdeferbody.swift
./validation-test/compiler_crashers_fixed/27484-swift-typebase-isspecialized.swift
./validation-test/compiler_crashers_fixed/01397-swift-availabilityattr-isunavailable.swift
./validation-test/compiler_crashers_fixed/26433-swift-diagnosticengine-emitdiagnostic.swift
./validation-test/compiler_crashers_fixed/27177-swift-funcdecl-setdeserializedsignature.swift
./validation-test/compiler_crashers_fixed/00604-swift-typebase-operator.swift
./validation-test/compiler_crashers_fixed/28808-hasval.swift
./validation-test/compiler_crashers_fixed/28778-hasaccessibility-accessibility-not-computed-yet.swift
./validation-test/compiler_crashers_fixed/25340-findlocalval-checkpattern.swift
./validation-test/compiler_crashers_fixed/25734-swift-conformancelookuptable-updatelookuptable.swift
./validation-test/compiler_crashers_fixed/25755-void.swift
./validation-test/compiler_crashers_fixed/28705-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/01410-swift-constraints-constraintsystem-lookupmember.swift
./validation-test/compiler_crashers_fixed/26650-swift-protocoltype-canonicalizeprotocols.swift
./validation-test/compiler_crashers_fixed/27935-swift-moduledecl-lookupconformance.swift
./validation-test/compiler_crashers_fixed/26449-swift-parser-parsetoken.swift
./validation-test/compiler_crashers_fixed/28000-swift-astcontext-getimplicitlyunwrappedoptionaldecl.swift
./validation-test/compiler_crashers_fixed/26467-swift-parser-parsedecl.swift
./validation-test/compiler_crashers_fixed/25690-swift-astvisitor.swift
./validation-test/compiler_crashers_fixed/01456-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/25608-swift-iterabledeclcontext-getmembers.swift
./validation-test/compiler_crashers_fixed/01965-swift-constraints-constraintsystem-diagnosefailurefromconstraints.swift
./validation-test/compiler_crashers_fixed/00479-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/25769-llvm-foldingset-swift-structtype-nodeequals.swift
./validation-test/compiler_crashers_fixed/28819-formextensioninterfacetype-swift-type-swift-genericparamlist.swift
./validation-test/compiler_crashers_fixed/01645-swift-typebase-getdesugaredtype.swift
./validation-test/compiler_crashers_fixed/28447-result-case-not-implemented-failed.swift
./validation-test/compiler_crashers_fixed/27764-swift-constraints-simplifylocator.swift
./validation-test/compiler_crashers_fixed/26842-swift-streamprinter-printtext.swift
./validation-test/compiler_crashers_fixed/26494-swift-diagnosticengine-flushactivediagnostic.swift
./validation-test/compiler_crashers_fixed/01173-swift-completegenerictyperesolver-resolvedependentmembertype.swift
./validation-test/compiler_crashers_fixed/02187-swift-protocoltype-canonicalizeprotocols.swift
./validation-test/compiler_crashers_fixed/00920-swift-typechecker-typecheckexpression.swift
./validation-test/compiler_crashers_fixed/27986-swift-abstractfunctiondecl-setgenericparams.swift
./validation-test/compiler_crashers_fixed/00792-swift-parser-parseexprarray.swift
./validation-test/compiler_crashers_fixed/26432-llvm-foldingsetimpl-findnodeorinsertpos.swift
./validation-test/compiler_crashers_fixed/27756-swift-modulefile-gettype.swift
./validation-test/compiler_crashers_fixed/26798-void.swift
./validation-test/compiler_crashers_fixed/27228-swift-conformancelookuptable-addprotocol.swift
./validation-test/compiler_crashers_fixed/02059-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/28470-anonymous-namespace-verifier-verifychecked-swift-type-llvm-smallptrset-swift-arc.swift
./validation-test/compiler_crashers_fixed/28156-swift-typechecker-lookupunqualified.swift
./validation-test/compiler_crashers_fixed/25388-swift-lexer-lexidentifier.swift
./validation-test/compiler_crashers_fixed/00979-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/26880-swift-astvisitor.random.swift
./validation-test/compiler_crashers_fixed/00489-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/28451-boundgeneric-getgenericargs-size-genericsig-getinnermostgenericparams-size-failed.swift
./validation-test/compiler_crashers_fixed/27199-swift-conformancelookuptable-lookupconformances.swift
./validation-test/compiler_crashers_fixed/28544-swift-type-transform-llvm-function-ref-swift-type-swift-type-const.swift
./validation-test/compiler_crashers_fixed/26261-swift-parser-skipsingle.swift
./validation-test/compiler_crashers_fixed/27711-swift-declcontext-getlocalconformances.swift
./validation-test/compiler_crashers_fixed/01835-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/00245-swift-constraints-constraintgraph-computeconnectedcomponents.swift
./validation-test/compiler_crashers_fixed/28601-getkind-exprkind-binary-isa-tupleexpr-e-binaryexprs-must-have-a-tupleexpr-as-the.swift
./validation-test/compiler_crashers_fixed/27085-swift-protocoldecl-existentialconformstoselfslow.swift
./validation-test/compiler_crashers_fixed/02244-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/28697-anonymous-namespace-findcapturedvars-checktype-swift-type-swift-sourceloc.swift
./validation-test/compiler_crashers_fixed/27412-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/28567-anonymous-namespace-verifier-verifychecked-swift-type-llvm-smallptrset-swift-arc.swift
./validation-test/compiler_crashers_fixed/00047-emitdirecttypemetadataref.swift
./validation-test/compiler_crashers_fixed/27052-swift-moduledecl-lookupconformance.swift
./validation-test/compiler_crashers_fixed/00425-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/01735-swift-constraints-constraintsystem-getfixedtyperecursive.swift
./validation-test/compiler_crashers_fixed/28275-swift-typebase-getsuperclass.swift
./validation-test/compiler_crashers_fixed/00967-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/25724-swift-valuedecl-getinterfacetype.swift
./validation-test/compiler_crashers_fixed/02110-swift-modulefile-gettype.swift
./validation-test/compiler_crashers_fixed/28072-swift-typechecker-buildrefexpr.swift
./validation-test/compiler_crashers_fixed/28758-swift-genericsignaturebuilder-resolvesuperconformance-swift-genericsignaturebuil.swift
./validation-test/compiler_crashers_fixed/00645-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/26035-swift-sourcemanager-extracttext.swift
./validation-test/compiler_crashers_fixed/00111-swift-constraints-constraintsystem-simplifyconstraint.swift
./validation-test/compiler_crashers_fixed/26033-swift-parser-parsetoken.swift
./validation-test/compiler_crashers_fixed/27708-swift-constraints-solution-solution.swift
./validation-test/compiler_crashers_fixed/27214-checkenumrawvalues.swift
./validation-test/compiler_crashers_fixed/01453-swift-constraints-constraintgraph-change-undo.swift
./validation-test/compiler_crashers_fixed/28539-swift-unqualifiedlookup-unqualifiedlookup-swift-declname-swift-declcontext-swift.swift
./validation-test/compiler_crashers_fixed/25547-swift-diagnosticengine-flushactivediagnostic.swift
./validation-test/compiler_crashers_fixed/01566-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/26767-swift-modulefile-maybereadgenericparams.swift
./validation-test/compiler_crashers_fixed/28726-nominaltypedecl-hasfixedlayout.swift
./validation-test/compiler_crashers_fixed/00613-connectedcomponentsdfs.swift
./validation-test/compiler_crashers_fixed/01218-void.swift
./validation-test/compiler_crashers_fixed/27017-swift-archetypebuilder-potentialarchetype-getarchetypeanchor.swift
./validation-test/compiler_crashers_fixed/01387-swift-astcontext-setconformsto.swift
./validation-test/compiler_crashers_fixed/25407-swift-conformancelookuptable-expandimpliedconformances.swift
./validation-test/compiler_crashers_fixed/28139-swift-classdecl-findoverridingdecl.swift
./validation-test/compiler_crashers_fixed/26315-swift-astcontext-allocate.swift
./validation-test/compiler_crashers_fixed/00163-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/01801-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/01741-swift-constraints-constraintsystem-simplifymemberconstraint.swift
./validation-test/compiler_crashers_fixed/25773-swift-declcontext-isprotocolorprotocolextensioncontext.swift
./validation-test/compiler_crashers_fixed/26406-swift-constraints-constraintgraph-change-undo.swift
./validation-test/compiler_crashers_fixed/28377-swift-expr-walk.swift
./validation-test/compiler_crashers_fixed/25527-swift-modulefile-getimportedmodules.swift
./validation-test/compiler_crashers_fixed/00285-getcallerdefaultarg.swift
./validation-test/compiler_crashers_fixed/00112-swift-constraints-constraintsystem-simplifytype.swift
./validation-test/compiler_crashers_fixed/01147-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/27248-swift-conformancelookuptable-lookupconformance.swift
./validation-test/compiler_crashers_fixed/28759-activediagnostic-already-have-an-active-diagnostic.swift
./validation-test/compiler_crashers_fixed/27139-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/00501-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/25765-swift-iterabledeclcontext-getmembers.swift
./validation-test/compiler_crashers_fixed/01217-swift-typechecker-resolveidentifiertype.swift
./validation-test/compiler_crashers_fixed/28627-unreachable-executed-at-swift-include-swift-ast-exprnodes-def-79.swift
./validation-test/compiler_crashers_fixed/00673-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/26298-llvm-densemapbase.swift
./validation-test/compiler_crashers_fixed/01611-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/26115-swift-constraints-constraintsystem-diagnosefailureforexpr.swift
./validation-test/compiler_crashers_fixed/02039-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/28672-result-case-not-implemented.swift
./validation-test/compiler_crashers_fixed/27464-swift-typebase-isequal.swift
./validation-test/compiler_crashers_fixed/26457-swift-constraints-constraintsystem-addconstraint.swift
./validation-test/compiler_crashers_fixed/01553-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/27003-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/27427-swift-protocolcompositiontyperepr-create.swift
./validation-test/compiler_crashers_fixed/27350-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/27219-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/01616-swift-constraints-constraintgraph-gatherconstraints.swift
./validation-test/compiler_crashers_fixed/27242-swift-genericparamlist-addnestedarchetypes.swift
./validation-test/compiler_crashers_fixed/28147-swift-mangle-mangler-mangledefaultargumententity.swift
./validation-test/compiler_crashers_fixed/25641-swift-constraints-constraintsystem-computeassigndesttype.swift
./validation-test/compiler_crashers_fixed/27619-swift-modulefile-getdecl.swift
./validation-test/compiler_crashers_fixed/01048-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/00412-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/01015-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/01491-llvm-raw-ostream-write.swift
./validation-test/compiler_crashers_fixed/27356-swift-constraints-constraintgraph-addconstraint.swift
./validation-test/compiler_crashers_fixed/26428-swift-parser-parsegenericwhereclause.swift
./validation-test/compiler_crashers_fixed/01264-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/25806-swift-derivedfileunit-lookupvalue.swift
./validation-test/compiler_crashers_fixed/01856-swift-parser-parsetypesimple.swift
./validation-test/compiler_crashers_fixed/02181-swift-modulefile-getdecl.swift
./validation-test/compiler_crashers_fixed/26392-swift-abstractclosureexpr-setparams.swift
./validation-test/compiler_crashers_fixed/25979-swift-constraints-constraintsystem-optimizeconstraints.swift
./validation-test/compiler_crashers_fixed/26679-vtable.swift
./validation-test/compiler_crashers_fixed/00552-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/25939-swift-tupleexpr-tupleexpr.swift
./validation-test/compiler_crashers_fixed/26624-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/00127-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/28452-this-genericenv-already-have-generic-context-failed.swift
./validation-test/compiler_crashers_fixed/26173-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/28846-swift-typebase-getdesugaredtype.swift
./validation-test/compiler_crashers_fixed/25904-swift-parser-parseexprcallsuffix.swift
./validation-test/compiler_crashers_fixed/01097-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/26945-swift-typebase-getmembersubstitutions.swift
./validation-test/compiler_crashers_fixed/27204-swift-expr-getloc.swift
./validation-test/compiler_crashers_fixed/27027-swift-namelookup-lookupinmodule.swift
./validation-test/compiler_crashers_fixed/01380-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/27815-swift-archetypetype-getnew.swift
./validation-test/compiler_crashers_fixed/25961-swift-sourcemanager-extracttext.swift
./validation-test/compiler_crashers_fixed/00364-swift-typechecker-isrepresentableinobjc.swift
./validation-test/compiler_crashers_fixed/00414-swift-archetypebuilder-resolvearchetype.swift
./validation-test/compiler_crashers_fixed/01064-swift-genericsignature-get.swift
./validation-test/compiler_crashers_fixed/01624-swift-namelookup-lookupinmodule.swift
./validation-test/compiler_crashers_fixed/28205-swift-typechecker-checkgenericarguments.swift
./validation-test/compiler_crashers_fixed/00006-swift-mangle-mangler-manglecontext.swift
./validation-test/compiler_crashers_fixed/00715-swift-constraints-constraintsystem-solve.swift
./validation-test/compiler_crashers_fixed/26002-swift-nominaltype-get.swift
./validation-test/compiler_crashers_fixed/01022-swift-genericsignature-get.swift
./validation-test/compiler_crashers_fixed/01024-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/26418-swift-genericsignature-get.swift
./validation-test/compiler_crashers_fixed/27731-swift-removeshadoweddecls.swift
./validation-test/compiler_crashers_fixed/27966-swift-dependentmembertype-get.swift
./validation-test/compiler_crashers_fixed/00735-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/01935-swift-genericfunctiontype-get.swift
./validation-test/compiler_crashers_fixed/00165-swift-typebase-getdesugaredtype.swift
./validation-test/compiler_crashers_fixed/00617-swift-modulefile-gettype.swift
./validation-test/compiler_crashers_fixed/00635-llvm-ondiskchainedhashtable-swift-modulefile-decltableinfo-find.swift
./validation-test/compiler_crashers_fixed/26057-swift-valuedecl-settype.swift
./validation-test/compiler_crashers_fixed/27460-swift-protocoltype-compareprotocols.swift
./validation-test/compiler_crashers_fixed/27411-swift-constraints-constraintsystem-simplifytype.swift
./validation-test/compiler_crashers_fixed/27020-llvm-foldingset-swift-tupletype-getnodeprofile.swift
./validation-test/compiler_crashers_fixed/26178-swift-modulefile-getdecl.swift
./validation-test/compiler_crashers_fixed/25871-swift-constraints-matchcallarguments.swift
./validation-test/compiler_crashers_fixed/26204-swift-typechecker-getinterfacetypefrominternaltype.swift
./validation-test/compiler_crashers_fixed/26137-swift-constraints-constraintsystem-addtypevariableconstraintstoworklist.swift
./validation-test/compiler_crashers_fixed/28110-swift-typechecker-resolvetypeincontext.swift
./validation-test/compiler_crashers_fixed/28531-swift-modulefile-getdecl-llvm-pointerembeddedint-unsigned-int-31-llvm-optional-s.swift
./validation-test/compiler_crashers_fixed/01177-std-function-func-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/27505-swift-diagnosticengine-emitdiagnostic.swift
./validation-test/compiler_crashers_fixed/27930-swift-clangimporter-implementation-importattributes.swift
./validation-test/compiler_crashers_fixed/00455-swift-parser-parseexprimpl.swift
./validation-test/compiler_crashers_fixed/25959-firsttarget.swift
./validation-test/compiler_crashers_fixed/00858-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/26349-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/01686-swift-astcontext-setconformsto.swift
./validation-test/compiler_crashers_fixed/01721-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/00440-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/25827-swift-typechecker-resolveinheritanceclause.swift
./validation-test/compiler_crashers_fixed/21655-swift-boundgenerictype-get.swift
./validation-test/compiler_crashers_fixed/23919-swift-astvisitor.swift
./validation-test/compiler_crashers_fixed/00530-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/01523-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/25589-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/25713-swift-dependentmembertype-get.swift
./validation-test/compiler_crashers_fixed/10023-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/27616-swift-nominaltypedecl-getmembers.swift
./validation-test/compiler_crashers_fixed/28038-swift-parser-parsetype.swift
./validation-test/compiler_crashers_fixed/01087-swift-declcontext-lookupqualified.swift
./validation-test/compiler_crashers_fixed/26474-std-function-func-swift-typechecker-validategenericfuncsignature.swift
./validation-test/compiler_crashers_fixed/01108-swift-constraints-constraintsystem-solve.swift
./validation-test/compiler_crashers_fixed/28386-swift-typebase-getdesugaredtype.swift
./validation-test/compiler_crashers_fixed/28587-child-source-range-not-contained-within-its-parent-sequence-expr-type-null.swift
./validation-test/compiler_crashers_fixed/01000-swift-parser-parsetypeidentifier.swift
./validation-test/compiler_crashers_fixed/25955-swift-tupletype-get.swift
./validation-test/compiler_crashers_fixed/26683-swift-generictypetoarchetyperesolver-resolvegenerictypeparamtype.swift
./validation-test/compiler_crashers_fixed/25346-swift-parser-skipsingle.swift
./validation-test/compiler_crashers_fixed/28760-dist-0-nested-type-should-have-matched-associated-type.swift
./validation-test/compiler_crashers_fixed/27210-swift-diagnosticengine-emitdiagnostic.swift
./validation-test/compiler_crashers_fixed/27060-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/26580-llvm-foldingset-swift-tupletype-nodeequals.swift
./validation-test/compiler_crashers_fixed/26169-swift-protocoltype-canonicalizeprotocols.swift
./validation-test/compiler_crashers_fixed/26529-swift-typechecker-validatetype.swift
./validation-test/compiler_crashers_fixed/01469-swift-modulefile-getdecl.swift
./validation-test/compiler_crashers_fixed/00942-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/26331-swift-parser-skipsingle.swift
./validation-test/compiler_crashers_fixed/25969-swift-protocoldecl-existentialtypesupportedslow.swift
./validation-test/compiler_crashers_fixed/27295-swift-structtype-get.swift
./validation-test/compiler_crashers_fixed/27788-swift-constraints-solution-solution.swift
./validation-test/compiler_crashers_fixed/02214-swift-inouttype-get.swift
./validation-test/compiler_crashers_fixed/01284-swift-parser-parseidentifier.swift
./validation-test/compiler_crashers_fixed/01932-swift-declname-printpretty.swift
./validation-test/compiler_crashers_fixed/00873-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/02175-swift-scopeinfo-addtoscope.swift
./validation-test/compiler_crashers_fixed/01138-void.swift
./validation-test/compiler_crashers_fixed/00235-swift-genericparamlist-print.swift
./validation-test/compiler_crashers_fixed/26763-swift-typechecker-overapproximateosversionsatlocation.swift
./validation-test/compiler_crashers_fixed/25683-swift-valuedecl-getinterfacetype.swift
./validation-test/compiler_crashers_fixed/25924-std-function-func-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/00092-swift-availabilityattr-isunavailable.swift
./validation-test/compiler_crashers_fixed/25429-swift-typechecker-resolvetypeincontext.swift
./validation-test/compiler_crashers_fixed/25880-swift-conformancelookuptable-conformancelookuptable.swift
./validation-test/compiler_crashers_fixed/02156-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/00459-swift-archetypetype-setnestedtypes.swift
./validation-test/compiler_crashers_fixed/26287-swift-constraints-constraintsystem-solve.swift
./validation-test/compiler_crashers_fixed/27559-swift-modulefile-maybereadforeignerrorconvention.swift
./validation-test/compiler_crashers_fixed/25888-swift-genericfunctiontype-get.swift
./validation-test/compiler_crashers_fixed/27633-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/27443-matchwitness.swift
./validation-test/compiler_crashers_fixed/27629-swift-associatedtypedecl-associatedtypedecl.swift
./validation-test/compiler_crashers_fixed/27472-swift-decl-walk.swift
./validation-test/compiler_crashers_fixed/26611-swift-genericsignature-get.swift
./validation-test/compiler_crashers_fixed/00388-swift-availabilityattr-isunavailable.swift
./validation-test/compiler_crashers_fixed/01207-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/00086-std-function-func-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/26364-swift-sourcemanager-extracttext.swift
./validation-test/compiler_crashers_fixed/27421-formatdiagnostictext.swift
./validation-test/compiler_crashers_fixed/25558-llvm-foldingset-swift-boundgenerictype-nodeequals.swift
./validation-test/compiler_crashers_fixed/00248-swift-clangmoduleunit-getimportedmodules.swift
./validation-test/compiler_crashers_fixed/01795-swift-pattern-foreachvariable.swift
./validation-test/compiler_crashers_fixed/01567-swift-tuplepattern-createsimple.swift
./validation-test/compiler_crashers_fixed/28231-swift-constraints-constraintsystem-solvesimplified.swift
./validation-test/compiler_crashers_fixed/26894-swift-lexer-kindofidentifier.swift
./validation-test/compiler_crashers_fixed/00919-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/00962-swift-protocoltype-canonicalizeprotocols.swift
./validation-test/compiler_crashers_fixed/28137-swift-identtyperepr-create.swift
./validation-test/compiler_crashers_fixed/26827-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/00224-swift-generictypeparamtype-get.swift
./validation-test/compiler_crashers_fixed/28481-anonymous-namespace-verifier-verifychecked-swift-type-llvm-smallptrset-swift-arc.swift
./validation-test/compiler_crashers_fixed/00655-swift-clangmoduleunit-getadaptermodule.swift
./validation-test/compiler_crashers_fixed/26066-swift-diagnosticengine-flushactivediagnostic.swift
./validation-test/compiler_crashers_fixed/00695-swift-availabilityattr-isunavailable.swift
./validation-test/compiler_crashers_fixed/27755-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/01195-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/00756-llvm-ondiskchainedhashtable-swift-modulefile-decltableinfo-find.swift
./validation-test/compiler_crashers_fixed/01607-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/00960-swift-funcdecl-setdeserializedsignature.swift
./validation-test/compiler_crashers_fixed/26058-swift-lexer-getlocforendoftoken.swift
./validation-test/compiler_crashers_fixed/00452-nanl.random.swift
./validation-test/compiler_crashers_fixed/00239-swiftdeclconverter-importconstructor.swift
./validation-test/compiler_crashers_fixed/28791-formprotocolrelativetype-swift-protocoldecl-swift-genericsignaturebuilder-potent.swift
./validation-test/compiler_crashers_fixed/27121-vtable.swift
./validation-test/compiler_crashers_fixed/26931-swift-modulefile-lookupvalue.swift
./validation-test/compiler_crashers_fixed/27280-swift-type-transform.swift
./validation-test/compiler_crashers_fixed/27941-swift-constraints-constraintgraph-removeconstraint.swift
./validation-test/compiler_crashers_fixed/00324-swift-shortcircuit-isequal.swift
./validation-test/compiler_crashers_fixed/01861-swift-parser-parseexprclosure.swift
./validation-test/compiler_crashers_fixed/26777-swift-typechecker-resolveidentifiertype.swift
./validation-test/compiler_crashers_fixed/01023-swift-constraints-constraintsystem-getfixedtyperecursive.swift
./validation-test/compiler_crashers_fixed/01028-swift-camel-case-getfirstword.swift
./validation-test/compiler_crashers_fixed/01251-getcallerdefaultarg.swift
./validation-test/compiler_crashers_fixed/01512-swift-optional-swift-infixoperatordecl.swift
./validation-test/compiler_crashers_fixed/26899-std-function-func-swift-constraints-constraintsystem-simplifytype.swift
./validation-test/compiler_crashers_fixed/00810-a-cd-x.swift
./validation-test/compiler_crashers_fixed/28362-swift-constraints-constraintgraphnode-getadjacency.swift
./validation-test/compiler_crashers_fixed/28070-swift-lexer-diagnose.swift
./validation-test/compiler_crashers_fixed/01357-swift-lexer-lexidentifier.swift
./validation-test/compiler_crashers_fixed/01687-swift-constraints-constraintgraph-removeconstraint.swift
./validation-test/compiler_crashers_fixed/00723-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/25668-llvm-foldingset-swift-tupletype-nodeequals.swift
./validation-test/compiler_crashers_fixed/26223-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/27063-swift-conformancelookuptable-lookupconformances.swift
./validation-test/compiler_crashers_fixed/25555-swift-funcdecl-setdeserializedsignature.swift
./validation-test/compiler_crashers_fixed/01438-swift-typebase-getanyoptionalobjecttype.swift
./validation-test/compiler_crashers_fixed/27592-swift-genericparamlist-addnestedarchetypes.swift
./validation-test/compiler_crashers_fixed/27250-swift-nominaltype-get.swift
./validation-test/compiler_crashers_fixed/01451-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/28694-result-case-not-implemented.swift
./validation-test/compiler_crashers_fixed/01704-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/00497-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/00887-swift-archetypebuilder-resolvearchetype.swift
./validation-test/compiler_crashers_fixed/28306-swift-lookupvisibledecls.swift
./validation-test/compiler_crashers_fixed/26550-swift-functiontype-get.swift
./validation-test/compiler_crashers_fixed/00874-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/00500-llvm-ondiskchainedhashtable-swift-modulefile-decltableinfo-find.swift
./validation-test/compiler_crashers_fixed/27782-swift-genericsignature-profile.swift
./validation-test/compiler_crashers_fixed/27229-swift-constraints-constraintgraph-computeconnectedcomponents.swift
./validation-test/compiler_crashers_fixed/24558-swift-typebase-gatherallsubstitutions.swift
./validation-test/compiler_crashers_fixed/00678-swift-availabilityattr-isunavailable.swift
./validation-test/compiler_crashers_fixed/26832-swift-typechecker-conformstoprotocol.swift
./validation-test/compiler_crashers_fixed/01662-llvm-ondiskchainedhashtable-swift-modulefile-decltableinfo-find.swift
./validation-test/compiler_crashers_fixed/00516-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/01926-swift-constraints-constraintgraph-addconstraint.swift
./validation-test/compiler_crashers_fixed/26584-swift-constraints-constraintgraph-change-undo.swift
./validation-test/compiler_crashers_fixed/28073-swift-parser-parsestmt.swift
./validation-test/compiler_crashers_fixed/25554-swift-archetypetype-getnestedtype.swift
./validation-test/compiler_crashers_fixed/01997-swift-typechecker-checksubstitutions.swift
./validation-test/compiler_crashers_fixed/02109-swift-constraints-solution-computesubstitutions.swift
./validation-test/compiler_crashers_fixed/01205-llvm-foldingsetnodeid-operator.swift
./validation-test/compiler_crashers_fixed/02220-swift-namelookup-lookupinmodule.swift
./validation-test/compiler_crashers_fixed/00959-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/27699-swift-typebase-isemptyexistentialcomposition.swift
./validation-test/compiler_crashers_fixed/26829-swift-declcontext-getlocalconformances.swift
./validation-test/compiler_crashers_fixed/01381-bool.swift
./validation-test/compiler_crashers_fixed/27240-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/28333-swift-typedecl-getdeclaredtype.swift
./validation-test/compiler_crashers_fixed/26336-swift-modulefile-maybereadgenericparams.swift
./validation-test/compiler_crashers_fixed/01460-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/27944-swift-astvisitor.swift
./validation-test/compiler_crashers_fixed/27208-swift-archetypebuilder-potentialarchetype-isbetterarchetypeanchor.swift
./validation-test/compiler_crashers_fixed/25539-std-function-func-mapsignaturetype.swift
./validation-test/compiler_crashers_fixed/00750-getcallerdefaultarg.swift
./validation-test/compiler_crashers_fixed/28560-unreachable-executed-at-swift-lib-ast-type-cpp-1104.swift
./validation-test/compiler_crashers_fixed/00564-swift-constraints-constraintsystem-getfixedtyperecursive.swift
./validation-test/compiler_crashers_fixed/02034-swift-optional-swift-diagnostic-operator.swift
./validation-test/compiler_crashers_fixed/25363-swift-archetypebuilder-addrequirement.swift
./validation-test/compiler_crashers_fixed/26444-swift-genericparamlist-create.swift
./validation-test/compiler_crashers_fixed/26689-swift-modulefile-gettype.swift
./validation-test/compiler_crashers_fixed/28395-swift-expr-propagatelvalueaccesskind.swift
./validation-test/compiler_crashers_fixed/27608-llvm-errs.swift
./validation-test/compiler_crashers_fixed/26221-swift-astcontext-loadextensions.swift
./validation-test/compiler_crashers_fixed/00894-std-function-func-swift-archetypebuilder-maptypeintocontext.swift
./validation-test/compiler_crashers_fixed/01914-swift-parser-parsetoken.swift
./validation-test/compiler_crashers_fixed/28297-swift-lookupvisibledecls.swift
./validation-test/compiler_crashers_fixed/26490-swift-conformancelookuptable-resolveconformances.swift
./validation-test/compiler_crashers_fixed/26376-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/28393-swift-type-transform.swift
./validation-test/compiler_crashers_fixed/26773-swift-diagnosticengine-diagnose.swift
./validation-test/compiler_crashers_fixed/27621-swift-getbuiltinvaluedecl.swift
./validation-test/compiler_crashers_fixed/28580-hastype-e-expected-type-to-have-been-set.swift
./validation-test/compiler_crashers_fixed/00472-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/01826-swift-typebase-getanyoptionalobjecttype.swift
./validation-test/compiler_crashers_fixed/28648-modifierarguments-empty-foundpipe-index-beyond-bounds-in-select-modifier.swift
./validation-test/compiler_crashers_fixed/25524-swift-constraints-constraintsystem-simplifytype.swift
./validation-test/compiler_crashers_fixed/00602-swift-modulefile-gettype.swift
./validation-test/compiler_crashers_fixed/01850-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/28471-anonymous-namespace-verifier-verifychecked-swift-type-llvm-smallptrset-swift-arc.swift
./validation-test/compiler_crashers_fixed/27110-swift-patternbindingdecl-setpattern.swift
./validation-test/compiler_crashers_fixed/27749-swift-archetypetype-getnew.swift
./validation-test/compiler_crashers_fixed/02127-swift-modulefile-maybereadpattern.swift
./validation-test/compiler_crashers_fixed/00203-swift-type-print.swift
./validation-test/compiler_crashers_fixed/00293-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/26509-swift-functiontype-get.swift
./validation-test/compiler_crashers_fixed/26037-swift-inflightdiagnostic-fixitreplacechars.swift
./validation-test/compiler_crashers_fixed/00492-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/28606-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/28086-swift-completegenerictyperesolver-resolvedependentmembertype.swift
./validation-test/compiler_crashers_fixed/01400-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/26112-swift-genericsignature-get.swift
./validation-test/compiler_crashers_fixed/26232-swift-tuplepattern-create.swift
./validation-test/compiler_crashers_fixed/27261-swift-modulefile-getcommentfordecl.swift
./validation-test/compiler_crashers_fixed/27690-swift-typechecker-substituteinputsugartypeforresult.swift
./validation-test/compiler_crashers_fixed/00246-swift-constraints-constraintsystem-getconstraintlocator.swift
./validation-test/compiler_crashers_fixed/26044-llvm-raw-ostream-write.swift
./validation-test/compiler_crashers_fixed/26290-swift-inouttype-get.swift
./validation-test/compiler_crashers_fixed/27074-swift-nominaltypedecl-preparelookuptable.swift
./validation-test/compiler_crashers_fixed/28766-swift-iterativetypechecker-isqualifiedlookupindeclcontextsatisfied-swift-declcon.swift
./validation-test/compiler_crashers_fixed/01297-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/25787-swift-diagnosticengine-flushactivediagnostic.swift
./validation-test/compiler_crashers_fixed/28675-swift-typebase-getdesugaredtype.swift
./validation-test/compiler_crashers_fixed/27185-swift-astcontext-getbridgedtoobjc.swift
./validation-test/compiler_crashers_fixed/27205-swift-nominaltypedecl-getmembers.swift
./validation-test/compiler_crashers_fixed/01414-swift-genericparamlist-create.swift
./validation-test/compiler_crashers_fixed/00528-swift-declcontext-lookupqualified.swift
./validation-test/compiler_crashers_fixed/01968-bool.swift
./validation-test/compiler_crashers_fixed/01848-swift-completegenerictyperesolver-resolvedependentmembertype.swift
./validation-test/compiler_crashers_fixed/27351-llvm-foldingset-swift-tupletype-nodeequals.swift
./validation-test/compiler_crashers_fixed/00464-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/01122-swift-constraints-constraintsystem-solve.swift
./validation-test/compiler_crashers_fixed/28562-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/27822-swift-modulefile-loadextensions.swift
./validation-test/compiler_crashers_fixed/02192-swift-scopeinfo-addtoscope.swift
./validation-test/compiler_crashers_fixed/01656-swift-astcontext-getconformsto.swift
./validation-test/compiler_crashers_fixed/01794-swift-astcontext-setconformsto.swift
./validation-test/compiler_crashers_fixed/02032-swift-typechecker-resolveidentifiertype.swift
./validation-test/compiler_crashers_fixed/27220-swift-constraints-constraintsystem-matchtypes.swift
./validation-test/compiler_crashers_fixed/26730-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/27413-swift-modulefile-getimportedmodules.swift
./validation-test/compiler_crashers_fixed/02029-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/00814-swift-constraints-constraintsystem-getfixedtyperecursive.swift
./validation-test/compiler_crashers_fixed/28012-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/09650-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/26997-swift-stmt-walk.swift
./validation-test/compiler_crashers_fixed/27509-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/02119-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/00652-swift-constraints-constraintgraphnode-addconstraint.swift
./validation-test/compiler_crashers_fixed/26074-swift-lexer-lexidentifier.swift
./validation-test/compiler_crashers_fixed/28082-bool.swift
./validation-test/compiler_crashers_fixed/01354-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/26636-swift-tuplepattern-create.swift
./validation-test/compiler_crashers_fixed/01075-swift-modulefile-lookupvalue.swift
./validation-test/compiler_crashers_fixed/00433-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/26003-swift-valuedecl-settype.swift
./validation-test/compiler_crashers_fixed/28831-type-ismaterializable-argument-to-setmustbematerializablerecursive-may-not-be-in.swift
./validation-test/compiler_crashers_fixed/27016-swift-constraints-constraintsystem-solverec.swift
./validation-test/compiler_crashers_fixed/01786-std-function-func-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/28725-gpdecl-getdepth-generictypeparamdecl-invaliddepth-parameter-hasnt-been-validated.swift
./validation-test/compiler_crashers_fixed/27980-matchcallarguments.swift
./validation-test/compiler_crashers_fixed/25666-swift-constraints-generalfailurediagnosis-diagnosegeneralconversionfailure.swift
./validation-test/compiler_crashers_fixed/00569-swift-declcontext-lookupqualified.swift
./validation-test/compiler_crashers_fixed/28537-result-case-not-implemented.swift
./validation-test/compiler_crashers_fixed/28835-type-hastypeparameter-already-have-an-interface-type.swift
./validation-test/compiler_crashers_fixed/01921-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/26167-swift-modulefile-getdecl.swift
./validation-test/compiler_crashers_fixed/25872-swift-modulefile-maybereadforeignerrorconvention.swift
./validation-test/compiler_crashers_fixed/01604-swift-parser-parseidentifier.swift
./validation-test/compiler_crashers_fixed/28422-swift-genericfunctiontype-get.swift
./validation-test/compiler_crashers_fixed/25509-swift-lexer-lexidentifier.swift
./validation-test/compiler_crashers_fixed/01695-swift-pattern-operator.swift
./validation-test/compiler_crashers_fixed/00198-swift-constraints-constraintgraph-gatherconstraints.swift
./validation-test/compiler_crashers_fixed/00525-swift-archetypebuilder-maptypeintocontext.swift
./validation-test/compiler_crashers_fixed/00989-swift-typechecker-computecaptures.swift
./validation-test/compiler_crashers_fixed/00709-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/26092-std-function-func-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/28274-swift-valuedecl-isinstancemember.swift
./validation-test/compiler_crashers_fixed/27361-llvm-foldingset-swift-constraints-constraintlocator-nodeequals.swift
./validation-test/compiler_crashers_fixed/26760-swift-diagnosticengine-emitdiagnostic.swift
./validation-test/compiler_crashers_fixed/26139-swift-abstractclosureexpr-setparams.swift
./validation-test/compiler_crashers_fixed/01571-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/00173-swift-typealiasdecl-typealiasdecl.swift
./validation-test/compiler_crashers_fixed/00319-std-function-func-swift-constraints-solution-computesubstitutions.swift
./validation-test/compiler_crashers_fixed/28293-irgensilfunction-visitfullapplysite.swift
./validation-test/compiler_crashers_fixed/08008-swift-typechecker-typecheckexpression.swift
./validation-test/compiler_crashers_fixed/26468-swift-lexer-leximpl.swift
./validation-test/compiler_crashers_fixed/26727-swift-modulefile-getdecl.swift
./validation-test/compiler_crashers_fixed/00355-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/27548-swift-constraints-constraintsystem-assignfixedtype.swift
./validation-test/compiler_crashers_fixed/26499-swift-constraints-constraintgraph-addconstraint.swift
./validation-test/compiler_crashers_fixed/00838-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/27098-swift-type-transform.swift
./validation-test/compiler_crashers_fixed/02142-formatdiagnostictext.swift
./validation-test/compiler_crashers_fixed/25438-swift-parser-parsedecl.swift
./validation-test/compiler_crashers_fixed/27051-swift-constraints-constraint-create.swift
./validation-test/compiler_crashers_fixed/27114-swift-valuedecl-settype.swift
./validation-test/compiler_crashers_fixed/26289-swift-typechecker-typecheckexpression.swift
./validation-test/compiler_crashers_fixed/26461-void.swift
./validation-test/compiler_crashers_fixed/28301-swift-constraints-constraintsystem-simplifyconstructionconstraint.swift
./validation-test/compiler_crashers_fixed/00802-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/01244-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/27648-llvm-smallvectorimpl-swift-decl-insert.swift
./validation-test/compiler_crashers_fixed/26082-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/27276-swift-constraints-constraintsystem-simplifyconformstoconstraint.swift
./validation-test/compiler_crashers_fixed/00909-a.swift
./validation-test/compiler_crashers_fixed/00712-swift-constraints-constraintgraph-gatherconstraints.swift
./validation-test/compiler_crashers_fixed/24680-swift-typechecker-validategenericfuncsignature.swift
./validation-test/compiler_crashers_fixed/28788-conformance-isconcrete-concrete-isexistentialtype.swift
./validation-test/compiler_crashers_fixed/01565-std-function-func-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/01145-swift-constraints-constraintsystem-addconstraint.swift
./validation-test/compiler_crashers_fixed/27486-swift-constraints-constraintsystem-findbestsolution.swift
./validation-test/compiler_crashers_fixed/25600-swift-declname-printpretty.swift
./validation-test/compiler_crashers_fixed/00090-swift-astcontext-getidentifier.swift
./validation-test/compiler_crashers_fixed/26970-swift-abstractstoragedecl-makeaddressedwithobservers.swift
./validation-test/compiler_crashers_fixed/01156-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/26877-swift-constraints-constraint-create.swift
./validation-test/compiler_crashers_fixed/26253-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/26283-swift-constraints-constraintsystem-simplifyconstraint.swift
./validation-test/compiler_crashers_fixed/00192-swift-astcontext-setconformsto.swift
./validation-test/compiler_crashers_fixed/27355-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/25449-swift-lexer-leximpl.swift
./validation-test/compiler_crashers_fixed/01731-swift-dictionarytype-get.swift
./validation-test/compiler_crashers_fixed/01653-swift-pattern-foreachvariable.swift
./validation-test/compiler_crashers_fixed/28227-swift-typechecker-gettypeofrvalue.swift
./validation-test/compiler_crashers_fixed/27215-llvm-smallvectorimpl-swift-protocolconformance-operator.swift
./validation-test/compiler_crashers_fixed/00738-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/28387-swift-typebase-gatherallsubstitutions.swift
./validation-test/compiler_crashers_fixed/28247-swift-constraints-constraintsystem-solverscope-solverscope.swift
./validation-test/compiler_crashers_fixed/25444-swift-archetypebuilder-finalize.swift
./validation-test/compiler_crashers_fixed/26615-swift-abstractstoragedecl-makecomputed.swift
./validation-test/compiler_crashers_fixed/01130-swift-declcontext-lookupqualified.swift
./validation-test/compiler_crashers_fixed/27245-swift-archetypebuilder-addconformancerequirement.swift
./validation-test/compiler_crashers_fixed/00378-swift-lexer-lexidentifier.swift
./validation-test/compiler_crashers_fixed/26249-swift-typebase-isspecialized.swift
./validation-test/compiler_crashers_fixed/01905-swift-optionaltype-get.swift
./validation-test/compiler_crashers_fixed/26703-swift-modulefile-getdeclcontext.swift
./validation-test/compiler_crashers_fixed/02121-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/28281-swift-typechecker-resolvewitness.swift
./validation-test/compiler_crashers_fixed/01113-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/01963-swift-nominaltypedecl-computetype.swift
./validation-test/compiler_crashers_fixed/01462-swift-archetypebuilder-resolvearchetype.swift
./validation-test/compiler_crashers_fixed/27678-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/26176-swift-declcontext-isprotocolorprotocolextensioncontext.swift
./validation-test/compiler_crashers_fixed/01679-swift-optional-swift-diagnostic-operator.swift
./validation-test/compiler_crashers_fixed/28392-swift-dependentgenerictyperesolver-resolveselfassociatedtype.swift
./validation-test/compiler_crashers_fixed/00783-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/25912-firsttarget.swift
./validation-test/compiler_crashers_fixed/28394-swift-typechecker-checkconformance.swift
./validation-test/compiler_crashers_fixed/00531-llvm-foldingsetnodeid-operator.swift
./validation-test/compiler_crashers_fixed/01299-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/00068-foldsequence.swift
./validation-test/compiler_crashers_fixed/26947-swift-constraints-constraintsystem-getconstraintlocator.swift
./validation-test/compiler_crashers_fixed/25678-llvm-bitstreamcursor-read.swift
./validation-test/compiler_crashers_fixed/24798-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/25673-swift-boundgenerictype-get.swift
./validation-test/compiler_crashers_fixed/28432-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/00562-swift-typechecker-typecheckexpression.swift
./validation-test/compiler_crashers_fixed/00174-swift-scopeinfo-addtoscope.swift
./validation-test/compiler_crashers_fixed/01658-swift-parser-parsetypeidentifier.swift
./validation-test/compiler_crashers_fixed/01162-swift-tuplepattern-create.swift
./validation-test/compiler_crashers_fixed/28554-reftype-hastypeparameter-cannot-have-a-dependent-type-here.swift
./validation-test/compiler_crashers_fixed/26685-swift-printingdiagnosticconsumer-handlediagnostic.swift
./validation-test/compiler_crashers_fixed/28701-false-should-have-found-context-by-now.swift
./validation-test/compiler_crashers_fixed/26464-getfileaux.swift
./validation-test/compiler_crashers_fixed/02225-swift-sourcemanager-getmessage.swift
./validation-test/compiler_crashers_fixed/01470-swift-modulefile-getdecl.swift
./validation-test/compiler_crashers_fixed/01846-swift-parser-parseexprpostfix.swift
./validation-test/compiler_crashers_fixed/27463-swift-parser-parseexprpostfix.swift
./validation-test/compiler_crashers_fixed/00167-swift-typebase-isexistentialtype.swift
./validation-test/compiler_crashers_fixed/25658-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/02015-swift-typebase-gettypeofmember.swift
./validation-test/compiler_crashers_fixed/00958-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/27473-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/01259-swift-modulefile-gettype.swift
./validation-test/compiler_crashers_fixed/28302-swift-paramdecl-createunboundself.swift
./validation-test/compiler_crashers_fixed/27096-void.swift
./validation-test/compiler_crashers_fixed/00204-swift-parser-parsedeclprotocol.swift
./validation-test/compiler_crashers_fixed/01808-std-function-func-swift-archetypebuilder-maptypeintocontext.swift
./validation-test/compiler_crashers_fixed/28670-reftype-hastypeparameter-cannot-have-a-dependent-type-here.swift
./validation-test/compiler_crashers_fixed/28833-foundintype-isexistentialtype.swift
./validation-test/compiler_crashers_fixed/28500-unreachable-executed-at-swift-lib-sema-typecheckdecl-cpp-1687.swift
./validation-test/compiler_crashers_fixed/01641-swift-modulefile-maybereadgenericparams.swift
./validation-test/compiler_crashers_fixed/27925-swift-modulefile-loadextensions.swift
./validation-test/compiler_crashers_fixed/28420-swift-lowering-emitconditionalcheckedcast.swift
./validation-test/compiler_crashers_fixed/00106-swift-constraints-constraintsystem-getfixedtyperecursive.swift
./validation-test/compiler_crashers_fixed/25892-llvm-mutablearrayref-swift-protocoldecl.swift
./validation-test/compiler_crashers_fixed/27976-swift-mangle-mangler-mangletype.swift
./validation-test/compiler_crashers_fixed/25737-swift-lexer-leximpl.swift
./validation-test/compiler_crashers_fixed/28191-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/00686-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/28250-swift-typechecker-typecheckdecl.swift
./validation-test/compiler_crashers_fixed/02166-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/00430-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/25686-swift-parser-parseexprclosure.swift
./validation-test/compiler_crashers_fixed/27615-swift-nominaltypedecl-prepareextensions.swift
./validation-test/compiler_crashers_fixed/28509-allowoverwrite-e-haslvalueaccesskind-l-value-access-kind-has-already-been-set.swift
./validation-test/compiler_crashers_fixed/00382-swift-completegenerictyperesolver-resolvedependentmembertype.swift
./validation-test/compiler_crashers_fixed/26448-swift-declcontext-isprotocolorprotocolextensioncontext.swift
./validation-test/compiler_crashers_fixed/28702-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/27126-swift-constraints-solution-solution.swift
./validation-test/compiler_crashers_fixed/26168-swift-modulefile-maybereadpattern.swift
./validation-test/compiler_crashers_fixed/28521-hastype-declaration-has-no-type-set-yet.swift
./validation-test/compiler_crashers_fixed/27586-swift-parser-consumetoken.swift
./validation-test/compiler_crashers_fixed/01953-swift-module-lookupconformance.swift
./validation-test/compiler_crashers_fixed/02196-swift-optional-swift-diagnostic-operator.swift
./validation-test/compiler_crashers_fixed/27580-swift-typebase-getmembersubstitutions.swift
./validation-test/compiler_crashers_fixed/00371-swift-archetypetype-setnestedtypes.swift
./validation-test/compiler_crashers_fixed/00256-swift-tupleexpr-create.swift
./validation-test/compiler_crashers_fixed/28461-child-source-range-not-contained-within-its-parent-if-stmt.swift
./validation-test/compiler_crashers_fixed/01586-swift-typechecker-checksubstitutions.swift
./validation-test/compiler_crashers_fixed/26977-checkenumrawvalues.swift
./validation-test/compiler_crashers_fixed/28775-gpdecl-getdepth-generictypeparamdecl-invaliddepth-parameter-hasnt-been-validated.swift
./validation-test/compiler_crashers_fixed/01437-swift-astprinter-printtextimpl.swift
./validation-test/compiler_crashers_fixed/28373-swift-printoptions-setarchetypeselftransform.swift
./validation-test/compiler_crashers_fixed/28563-swift-modulefile-lookupvalue-swift-declname-llvm-smallvectorimpl-swift-valuedecl.swift
./validation-test/compiler_crashers_fixed/25726-swift-parser-parsetoken.swift
./validation-test/compiler_crashers_fixed/27995-swift-constraints-constraintsystem-simplifyconstructionconstraint.swift
./validation-test/compiler_crashers_fixed/27683-swift-tuplepattern-create.swift
./validation-test/compiler_crashers_fixed/27512-llvm-foldingset-swift-genericfunctiontype-nodeequals.swift
./validation-test/compiler_crashers_fixed/25670-swift-conformancelookuptable-addprotocol.swift
./validation-test/compiler_crashers_fixed/00700-swift-constraints-constraintsystem-matchdeepequalitytypes.swift
./validation-test/compiler_crashers_fixed/26856-swift-constraints-constraintsystem-solverec.swift
./validation-test/compiler_crashers_fixed/01160-swift-genericparamlist-addnestedarchetypes.swift
./validation-test/compiler_crashers_fixed/28822-formprotocolrelativetype-swift-protocoldecl-swift-genericsignaturebuilder-potent.swift
./validation-test/compiler_crashers_fixed/27553-swift-conformancelookuptable-getconformingcontext.swift
./validation-test/compiler_crashers_fixed/28209-swift-protocoldecl-requiresclassslow.swift
./validation-test/compiler_crashers_fixed/27654-swift-streamprinter-printtext.swift
./validation-test/compiler_crashers_fixed/28264-swift-valuedecl-getinterfacetype.swift
./validation-test/compiler_crashers_fixed/28611-isa-x-val-cast-ty-argument-of-incompatible-type.swift
./validation-test/compiler_crashers_fixed/26712-swift-genericparamlist-addnestedarchetypes.swift
./validation-test/compiler_crashers_fixed/26677-swift-parser-diagnoseredefinition.swift
./validation-test/compiler_crashers_fixed/02031-llvm-foldingset-swift-boundgenerictype-nodeequals.swift
./validation-test/compiler_crashers_fixed/28498-anonymous-namespace-verifier-walktostmtpost-swift-stmt.swift
./validation-test/compiler_crashers_fixed/28150-swift-astcontext-loadextensions.swift
./validation-test/compiler_crashers_fixed/28225-swift-typechecker-checkconformance.swift
./validation-test/compiler_crashers_fixed/01503-swift-constraints-constraintlocator-profile.swift
./validation-test/compiler_crashers_fixed/25857-swift-abstractstoragedecl-makecomputed.swift
./validation-test/compiler_crashers_fixed/01628-llvm-ondiskchainedhashtable-swift-modulefile-decltableinfo-find.swift
./validation-test/compiler_crashers_fixed/02126-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/27908-llvm-smallvectorimpl-swift-diagnosticargument-operator.swift
./validation-test/compiler_crashers_fixed/01073-swift-constraints-constraintgraphnode-addconstraint.swift
./validation-test/compiler_crashers_fixed/00777-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/02129-swift-clangmoduleunit-getimportedmodules.swift
./validation-test/compiler_crashers_fixed/00536-vtable.swift
./validation-test/compiler_crashers_fixed/26546-swift-parser-skipsingle.swift
./validation-test/compiler_crashers_fixed/27336-swift-existentialmetatypetype-get.swift
./validation-test/compiler_crashers_fixed/27339-llvm-foldingset-swift-tupletype-nodeequals.swift
./validation-test/compiler_crashers_fixed/27025-llvm-ondiskchainedhashtable-swift-modulefile-decltableinfo-find.swift
./validation-test/compiler_crashers_fixed/27256-swift-constraints-constraintlocator-profile.swift
./validation-test/compiler_crashers_fixed/28566-env-dependent-type-in-non-generic-context.swift
./validation-test/compiler_crashers_fixed/00278-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/26078-swift-constraints-constraintsystem-matchtypes.swift
./validation-test/compiler_crashers_fixed/27742-matchwitness.swift
./validation-test/compiler_crashers_fixed/00142-swift-nominaltypedecl-preparelookuptable.swift
./validation-test/compiler_crashers_fixed/28004-swift-parser-parseexprsequence.swift
./validation-test/compiler_crashers_fixed/25801-swift-sourcefile-lookupcache-lookupvalue.swift
./validation-test/compiler_crashers_fixed/25614-llvm-mutablearrayref-swift-protocoldecl.swift
./validation-test/compiler_crashers_fixed/01277-diagnoseunknowntype.swift
./validation-test/compiler_crashers_fixed/28442-swift-typebase-getrvaluetype.swift
./validation-test/compiler_crashers_fixed/25944-swift-parser-parsestmtfor.swift
./validation-test/compiler_crashers_fixed/28060-std-function-func.swift
./validation-test/compiler_crashers_fixed/00514-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/02157-swift-nominaltypedecl-computetype.swift
./validation-test/compiler_crashers_fixed/25434-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/27829-swift-typechecker-lookupmembertype.swift
./validation-test/compiler_crashers_fixed/00020-swift-typechecker-conformstoprotocol.swift
./validation-test/compiler_crashers_fixed/26309-swift-typebase-getimplicitlyunwrappedoptionalobjecttype.swift
./validation-test/compiler_crashers_fixed/26476-swift-astcontext-allocate.swift
./validation-test/compiler_crashers_fixed/27410-swift-constraints-constraintgraph-computeconnectedcomponents.swift
./validation-test/compiler_crashers_fixed/00955-swift-genericparamlist-addnestedarchetypes.swift
./validation-test/compiler_crashers_fixed/27680-swift-structtype-get.swift
./validation-test/compiler_crashers_fixed/25571-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/26560-swift-diagnosticengine-flushactivediagnostic.swift
./validation-test/compiler_crashers_fixed/02168-swift-nominaltypedecl-getdeclaredtypeincontext.swift
./validation-test/compiler_crashers_fixed/00688-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/26893-swift-constraints-constraintgraphscope-constraintgraphscope.swift
./validation-test/compiler_crashers_fixed/13000-swift-constraints-constraintsystem-matchtypes.swift
./validation-test/compiler_crashers_fixed/00089-swift-archetypetype-setnestedtypes.swift
./validation-test/compiler_crashers_fixed/27879-swift-polymorphicfunctiontype-get.swift
./validation-test/compiler_crashers_fixed/00767-swift-constraints-constraintsystem-solve.swift
./validation-test/compiler_crashers_fixed/25923-swift-typechecker-typecheckexpression.swift
./validation-test/compiler_crashers_fixed/28263-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/01712-swift-boundgenerictype-get.swift
./validation-test/compiler_crashers_fixed/25750-swift-lvaluetype-get.swift
./validation-test/compiler_crashers_fixed/00863-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/00668-swift-typebase-getcanonicaltype.swift
./validation-test/compiler_crashers_fixed/00903-swift-scopeinfo-addtoscope.swift
./validation-test/compiler_crashers_fixed/26707-swift-moduledecl-lookupconformance.swift
./validation-test/compiler_crashers_fixed/27449-swift-constraints-constraintsystem-solverec.swift
./validation-test/compiler_crashers_fixed/01092-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/26387-swift-parser-diagnose.swift
./validation-test/compiler_crashers_fixed/01290-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/01585-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/00445-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/26110-swift-nominaltypedecl-preparelookuptable.swift
./validation-test/compiler_crashers_fixed/01056-swift-typechecker-conformstoprotocol.swift
./validation-test/compiler_crashers_fixed/01096-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/00132-swift-lexer-lexoperatoridentifier.swift
./validation-test/compiler_crashers_fixed/27400-swift-protocolconformance-getinheritedconformance.swift
./validation-test/compiler_crashers_fixed/25712-swift-conformancelookuptable-updatelookuptable.swift
./validation-test/compiler_crashers_fixed/26405-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/25624-swift-moduledecl-lookupvalue.swift
./validation-test/compiler_crashers_fixed/26008-swift-modulefile-getdecl.swift
./validation-test/compiler_crashers_fixed/01370-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/02163-swift-parser-parseexprlist.swift
./validation-test/compiler_crashers_fixed/02211-swift-nominaltypedecl-preparelookuptable.swift
./validation-test/compiler_crashers_fixed/27259-std-function-func-swift-type-subst.swift
./validation-test/compiler_crashers_fixed/26389-swift-typechecker-validatedecl.swift
./validation-test/compiler_crashers_fixed/27896-swift-modulefile-configurestorage.swift
./validation-test/compiler_crashers_fixed/01426-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/26722-swift-parser-parsedaccessors-record.swift
./validation-test/compiler_crashers_fixed/00400-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/26975-swift-constraints-solution-solution.swift
./validation-test/compiler_crashers_fixed/27399-swift-constraints-constraintsystem-getfixedtyperecursive.swift
./validation-test/compiler_crashers_fixed/25327-swift-metatypetype-get.swift
./validation-test/compiler_crashers_fixed/27978-swift-typechecker-solveforexpression.swift
./validation-test/compiler_crashers_fixed/00865-swift-constraints-constraintsystem-gettypeofmemberreference.swift
./validation-test/compiler_crashers_fixed/00240-argemitter-emitexpanded.swift
./validation-test/compiler_crashers_fixed/01263-no-stacktrace.swift
./validation-test/compiler_crashers_fixed/28427-swift-lexer-lexstringliteral.swift
./validation-test/compiler_crashers_fixed/27632-swift-typechecker-typecheckdecl.swift
./validation-test/compiler_crashers_fixed/26699-swift-expr-walk.swift
./validation-test/compiler_crashers_fixed/27918-swift-archetypebuilder-potentialarchetype-gettype.swift
./validation-test/compiler_crashers_fixed/26626-swift-constraints-constraintgraph-computeconnectedcomponents.swift
./validation-test/compiler_crashers_fixed/25396-swift-typechecker-validatetype.swift
./validation-test/compiler_crashers_fixed/25448-swift-archetypebuilder-addrequirement.swift
./validation-test/compiler_crashers_fixed/06207-swift-diagnosticengine-flushactivediagnostic.swift
./validation-test/compiler_crashers_fixed/28664-typevariables-impl-getgraphindex-typevar-type-variable-mismatch.swift
./validation-test/compiler_crashers_fixed/26210-swift-boundgenerictype-get.swift
./validation-test/compiler_crashers_fixed/28619-basety-islvaluetype-basety-is-anymetatypetype.swift
./validation-test/compiler_crashers_fixed/01257-swift-declcontext-lookupqualified.swift
./validation-test/compiler_crashers_fixed/27075-swift-type-transform.swift
./validation-test/compiler_crashers_fixed/02164-swift-typechecker-checksubstitutions.swift
./validation-test/compiler_crashers_fixed/00868-x.swift
./validation-test/compiler_crashers_fixed/25894-swift-inflightdiagnostic.swift
./validation-test/compiler_crashers_fixed/25954-swift-parser-parseidentifier.swift
./validation-test/compiler_crashers_fixed/00362-clang-stmt-statisticsenabled.swift
./validation-test/compiler_crashers_fixed/00178-llvm-foldingset-swift-genericsignature-nodeequals.swift
./validation-test/compiler_crashers_fixed/00762-swift-nominaltypedecl-computetype.swift
./validation-test/compiler_crashers_fixed/01858-llvm-densemap-swift-valuedecl.swift
./validation-test/compiler_crashers_fixed/01187-swift-type-walk.swift
./validation-test/compiler_crashers_fixed/27775-swift-typechecker-typecheckpattern.swift
./validation-test/compiler_crashers_fixed/26774-swift-protocoltype-canonicalizeprotocols.swift
./validation-test/compiler_crashers_fixed/25369-swift-iterabledeclcontext-getmembers.swift
./validation-test/compiler_crashers_fixed/28179-void.swift
./validation-test/compiler_crashers_fixed/26015-llvm-optional-swift-diagnostic-operator.swift
./validation-test/compiler_crashers_fixed/26088-swift-arrayslicetype-get.swift
./validation-test/compiler_crashers_fixed/01493-swift-constraints-constraintlocator-profile.swift
./validation-test/compiler_crashers_fixed/00836-resolvetypedecl.swift
./validation-test/compiler_crashers_fixed/26274-swift-typebase-getanyoptionalobjecttype.swift
./validation-test/compiler_crashers_fixed/27174-swift-valuedecl-getoverloadsignature.swift
./validation-test/compiler_crashers_fixed/28146-swift-clangimporter-implementation-importdeclandcacheimpl.swift
./validation-test/compiler_crashers_fixed/28849-hasval.swift
./validation-test/compiler_crashers_fixed/25651-swift-constraints-constraintsystem-addoverloadset.swift
./validation-test/compiler_crashers_fixed/26533-checktypeaccessibility.swift
./validation-test/compiler_crashers_fixed/27437-llvm-smallvectorimpl-swift-diagnosticargument-operator.swift
./validation-test/compiler_crashers_fixed/25779-swift-lexer-lexoperatoridentifier.swift
./validation-test/compiler_crashers_fixed/25357-swift-parser-parseexprorstmt.swift
./validation-test/compiler_crashers_fixed/27692-swift-constraints-simplifylocator.swift
./validation-test/compiler_crashers_fixed/26116-swift-parser-parsedecl.swift
./validation-test/compiler_crashers_fixed/27590-swift-generictypeparamtype-get.swift
./validation-test/compiler_crashers_fixed/27856-swift-constraints-constraintlocator-profile.swift
./validation-test/compiler_crashers_fixed/25751-swift-expr-findexistinginitializercontext.swift
./validation-test/compiler_crashers_fixed/00658-swift-constraints-constraint-create.swift
./validation-test/compiler_crashers_fixed/27045-swift-lexer-diagnose.swift
./validation-test/compiler_crashers_fixed/26030-llvm-bitstreamcursor-read.swift
./validation-test/compiler_crashers_fixed/01136-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/26813-generic-enum-tuple-optional-payload.swift
./validation-test/compiler_crashers_fixed/01830-swift-constraints-constraintgraphnode-getadjacency.swift
./validation-test/compiler_crashers_fixed/02190-getselftypeforcontainer.swift
./validation-test/compiler_crashers_fixed/25566-swift-typechecker-resolvetypeincontext.swift
./validation-test/compiler_crashers_2
./validation-test/compiler_crashers_2/sr11108.swift
./validation-test/compiler_crashers_2/0207-sr7371.swift
./validation-test/compiler_crashers_2/rdar56398071.swift
./validation-test/compiler_crashers_2/0189-sr10033.swift
./validation-test/compiler_crashers_2/0208-sr8751.swift
./validation-test/StdlibUnittest
./validation-test/StdlibUnittest/Failure.swift
./validation-test/StdlibUnittest/SequencesCollections.swift.gyb
./validation-test/StdlibUnittest/AtomicInt.swift
./validation-test/StdlibUnittest/CommandLine.swift
./validation-test/StdlibUnittest/StaticAssertions.swift
./validation-test/StdlibUnittest/RunNoTests.swift
./validation-test/StdlibUnittest/FreeBSD.swift
./validation-test/StdlibUnittest/CheckEquatable.swift.gyb
./validation-test/StdlibUnittest/Cygwin.swift
./validation-test/StdlibUnittest/Common.swift
./validation-test/StdlibUnittest/Misc.swift
./validation-test/StdlibUnittest/CrashingTests.swift
./validation-test/StdlibUnittest/Assertions.swift.gyb
./validation-test/StdlibUnittest/IOS.swift
./validation-test/StdlibUnittest/IOSSimulator.swift
./validation-test/StdlibUnittest/Linux.swift
./validation-test/StdlibUnittest/ChildProcessShutdown
./validation-test/StdlibUnittest/ChildProcessShutdown/FailIfChildExitsDuringShutdown.swift
./validation-test/StdlibUnittest/ChildProcessShutdown/FailIfChildCrashesDuringShutdown.swift
./validation-test/StdlibUnittest/ChildProcessShutdown/RequireOwnProcess.swift
./validation-test/StdlibUnittest/ChildProcessShutdown/PassIfChildCrashedDuringTestExecution.swift
./validation-test/StdlibUnittest/RaceTest.swift
./validation-test/StdlibUnittest/RangeSet.swift
./validation-test/StdlibUnittest/Filter.swift
./validation-test/StdlibUnittest/PS4.swift
./validation-test/StdlibUnittest/NSException.swift
./validation-test/StdlibUnittest/Android.swift
./validation-test/StdlibUnittest/Stdin.swift
./validation-test/StdlibUnittest/FoundationExtras.swift
./validation-test/StdlibUnittest/ForgotToRunTests.swift
./validation-test/StdlibUnittest/RunAllTestsCalledTwice.swift
./validation-test/compiler_crashers_2_fixed
./validation-test/compiler_crashers_2_fixed/sr-5836.swift
./validation-test/compiler_crashers_2_fixed/0178-rdar-45060773.swift
./validation-test/compiler_crashers_2_fixed/0012-rdar20270240.swift
./validation-test/compiler_crashers_2_fixed/0018-rdar21524144.swift
./validation-test/compiler_crashers_2_fixed/0208-rdar55864759.swift
./validation-test/compiler_crashers_2_fixed/0048-sr2333.swift
./validation-test/compiler_crashers_2_fixed/0187-rdar46678653.swift
./validation-test/compiler_crashers_2_fixed/0161-sr6569.swift
./validation-test/compiler_crashers_2_fixed/0151-rdar-39040593.swift
./validation-test/compiler_crashers_2_fixed/0165-rdar40722855.swift
./validation-test/compiler_crashers_2_fixed/0186-rdar46497155.swift
./validation-test/compiler_crashers_2_fixed/0009-rdar18996669.swift
./validation-test/compiler_crashers_2_fixed/0043-rdar25298116.swift
./validation-test/compiler_crashers_2_fixed/0112-rdar33139928.swift
./validation-test/compiler_crashers_2_fixed/0200-rdar48994748.swift
./validation-test/compiler_crashers_2_fixed/0149-sr-7282.swift
./validation-test/compiler_crashers_2_fixed/0103-sr4743.swift
./validation-test/compiler_crashers_2_fixed/0071-sr3714.swift
./validation-test/compiler_crashers_2_fixed/0169-sr8179.swift
./validation-test/compiler_crashers_2_fixed/0051-sr3212.swift
./validation-test/compiler_crashers_2_fixed/sr10937.swift
./validation-test/compiler_crashers_2_fixed/sr11232.swift
./validation-test/compiler_crashers_2_fixed/0021-rdar21333511.swift
./validation-test/compiler_crashers_2_fixed/0124-sr5825.swift
./validation-test/compiler_crashers_2_fixed/0070-sr3515.swift
./validation-test/compiler_crashers_2_fixed/0140-sr6746.swift
./validation-test/compiler_crashers_2_fixed/0127-sr5546.swift
./validation-test/compiler_crashers_2_fixed/0149-rdar34852808.swift
./validation-test/compiler_crashers_2_fixed/0106-rdar32700180.swift
./validation-test/compiler_crashers_2_fixed/0099-sr4973.swift
./validation-test/compiler_crashers_2_fixed/0020-rdar21598514.swift
./validation-test/compiler_crashers_2_fixed/rdar57040259.swift
./validation-test/compiler_crashers_2_fixed/0016-rdar21437203.swift
./validation-test/compiler_crashers_2_fixed/0173-circular-generic-type-alias-deserialization.swift
./validation-test/compiler_crashers_2_fixed/0031-rdar19606899.swift
./validation-test/compiler_crashers_2_fixed/0105-sr1261.swift
./validation-test/compiler_crashers_2_fixed/rdar54609704.swift
./validation-test/compiler_crashers_2_fixed/0188-sr9496.swift
./validation-test/compiler_crashers_2_fixed/sr11236.swift
./validation-test/compiler_crashers_2_fixed/0120-rdar34184392.swift
./validation-test/compiler_crashers_2_fixed/0199-sr9583.swift
./validation-test/compiler_crashers_2_fixed/0032-rdar19919421.swift
./validation-test/compiler_crashers_2_fixed/0209-rdar56055600.swift
./validation-test/compiler_crashers_2_fixed/0046-recursive-generic-arg-in-inherited-clause.swift
./validation-test/compiler_crashers_2_fixed/0210-rdar57356196.swift
./validation-test/compiler_crashers_2_fixed/0114-rdar33189068.swift
./validation-test/compiler_crashers_2_fixed/0153-rdar39130543.swift
./validation-test/compiler_crashers_2_fixed/0097-rdar32077627.swift
./validation-test/compiler_crashers_2_fixed/0121-rdar26498438.swift
./validation-test/compiler_crashers_2_fixed/sr10108.swift
./validation-test/compiler_crashers_2_fixed/0017-rdar21087186.swift
./validation-test/compiler_crashers_2_fixed/0122-rdar30965000.swift
./validation-test/compiler_crashers_2_fixed/0162-sr8019.swift
./validation-test/compiler_crashers_2_fixed/0165-sr8240.swift
./validation-test/compiler_crashers_2_fixed/0147-rdar38505436.swift
./validation-test/compiler_crashers_2_fixed/0196-rdar48937223.swift
./validation-test/compiler_crashers_2_fixed/0027-rdar21514140.swift
./validation-test/compiler_crashers_2_fixed/0160-sr7958.swift
./validation-test/compiler_crashers_2_fixed/0159-rdar39931339.swift
./validation-test/compiler_crashers_2_fixed/0133-rdar35832679.swift
./validation-test/compiler_crashers_2_fixed/sr11684.swift
./validation-test/compiler_crashers_2_fixed/0181-sr8930.swift
./validation-test/compiler_crashers_2_fixed/sr9199.swift
./validation-test/compiler_crashers_2_fixed/0164-sr7989.swift
./validation-test/compiler_crashers_2_fixed/0024-rdar21551616.swift
./validation-test/compiler_crashers_2_fixed/sr10992.swift
./validation-test/compiler_crashers_2_fixed/0152-rdar39253925.swift
./validation-test/compiler_crashers_2_fixed/sr12863.swift
./validation-test/compiler_crashers_2_fixed/0037-SILWitnessVisitor.swift
./validation-test/compiler_crashers_2_fixed/0166-rdar30168645.swift
./validation-test/compiler_crashers_2_fixed/0033-rdar21945994.swift
./validation-test/compiler_crashers_2_fixed/0198-rdar52081852.swift
./validation-test/compiler_crashers_2_fixed/0034-rdar21982453.swift
./validation-test/compiler_crashers_2_fixed/0129-rdar35019075.swift
./validation-test/compiler_crashers_2_fixed/0204-rdar54150921.swift
./validation-test/compiler_crashers_2_fixed/0110-sr4786.swift
./validation-test/compiler_crashers_2_fixed/0067-typeof-check-source-ranges.swift
./validation-test/compiler_crashers_2_fixed/0172-rdar-44235762.swift
./validation-test/compiler_crashers_2_fixed/0183-sr8998.swift
./validation-test/compiler_crashers_2_fixed/0059-sr3321.swift
./validation-test/compiler_crashers_2_fixed/0134-rdar35947198.swift
./validation-test/compiler_crashers_2_fixed/0112-rdar33135487.swift
./validation-test/compiler_crashers_2_fixed/0057-rdar29587093.swift
./validation-test/compiler_crashers_2_fixed/0072-sr3895.swift
./validation-test/compiler_crashers_2_fixed/0108-sr4088.swift
./validation-test/compiler_crashers_2_fixed/0122-rdar27383752.swift
./validation-test/compiler_crashers_2_fixed/0090-sr4617.swift
./validation-test/compiler_crashers_2_fixed/0104-sr4388.swift
./validation-test/compiler_crashers_2_fixed/0160-rdar41141944.swift
./validation-test/compiler_crashers_2_fixed/0170-sr8475.swift
./validation-test/compiler_crashers_2_fixed/0003-rdar20564378.swift
./validation-test/compiler_crashers_2_fixed/0007-rdar20750480.swift
./validation-test/compiler_crashers_2_fixed/0191-sr9508.swift
./validation-test/compiler_crashers_2_fixed/sr12998.swift
./validation-test/compiler_crashers_2_fixed/0010-rdar20638881.swift
./validation-test/compiler_crashers_2_fixed/sr9225.swift
./validation-test/compiler_crashers_2_fixed/0087-sr4016.swift
./validation-test/compiler_crashers_2_fixed/0180-rdar45557325.swift
./validation-test/compiler_crashers_2_fixed/sr11394.swift
./validation-test/compiler_crashers_2_fixed/0004-rdar20564605.swift
./validation-test/compiler_crashers_2_fixed/sr11599.swift
./validation-test/compiler_crashers_2_fixed/0168-rdar40164371.swift
./validation-test/compiler_crashers_2_fixed/0184-8764.swift
./validation-test/compiler_crashers_2_fixed/0152-sr-7397.swift
./validation-test/compiler_crashers_2_fixed/0179-rdar44963974.swift
./validation-test/compiler_crashers_2_fixed/0003-rdar20740573.swift
./validation-test/compiler_crashers_2_fixed/0062-rdar28765265.swift
./validation-test/compiler_crashers_2_fixed/sr11624.swift
./validation-test/compiler_crashers_2_fixed/0131-sr6466.swift
./validation-test/compiler_crashers_2_fixed/0074-rdar28544316.swift
./validation-test/compiler_crashers_2_fixed/0174-rdar44770297.swift
./validation-test/compiler_crashers_2_fixed/0193-sr10256.swift
./validation-test/compiler_crashers_2_fixed/sr-10612.swift
./validation-test/compiler_crashers_2_fixed/0061-sr3173.swift
./validation-test/compiler_crashers_2_fixed/0066-sr3687.swift
./validation-test/compiler_crashers_2_fixed/0105-sr5050.swift
./validation-test/compiler_crashers_2_fixed/sr8469.swift
./validation-test/compiler_crashers_2_fixed/sr11600.swift
./validation-test/compiler_crashers_2_fixed/0069-sr3657.swift
./validation-test/compiler_crashers_2_fixed/0095-rdar30154791.swift
./validation-test/compiler_crashers_2_fixed/sr12496.swift
./validation-test/compiler_crashers_2_fixed/0066-sr3687-updated.swift
./validation-test/compiler_crashers_2_fixed/0011-rdar21042357.swift
./validation-test/compiler_crashers_2_fixed/0156-rdar39636312.swift
./validation-test/compiler_crashers_2_fixed/0153-rdar36497404.swift
./validation-test/compiler_crashers_2_fixed/0132-rdar35699666.swift
./validation-test/compiler_crashers_2_fixed/rdar58941114.swift
./validation-test/compiler_crashers_2_fixed/0077-sr3884.swift
./validation-test/compiler_crashers_2_fixed/0111-rdar33067102.swift
./validation-test/compiler_crashers_2_fixed/sr8467-4-invalid-read-get-extra-info.swift
./validation-test/compiler_crashers_2_fixed/0040-rdar23899799-broken-bool.swift
./validation-test/compiler_crashers_2_fixed/0084-rdar31093854.swift
./validation-test/compiler_crashers_2_fixed/0175-sr8812.swift
./validation-test/compiler_crashers_2_fixed/0118-rdar31529413.swift
./validation-test/compiler_crashers_2_fixed/0060-sr2702.swift
./validation-test/compiler_crashers_2_fixed/0029-rdar21389284.swift
./validation-test/compiler_crashers_2_fixed/0157-rdar37730691.swift
./validation-test/compiler_crashers_2_fixed/0039-typechecker-crash.swift
./validation-test/compiler_crashers_2_fixed/0079-rdar30702721.swift
./validation-test/compiler_crashers_2_fixed/0136-rdar35082483.swift
./validation-test/compiler_crashers_2_fixed/sr11392.swift
./validation-test/compiler_crashers_2_fixed/0026-rdar21382194.swift
./validation-test/compiler_crashers_2_fixed/0098-rdar30354669.swift
./validation-test/compiler_crashers_2_fixed/0093-sr-4471.swift
./validation-test/compiler_crashers_2_fixed/sr11027.swift
./validation-test/compiler_crashers_2_fixed/sr11062.swift
./validation-test/compiler_crashers_2_fixed/sr10062.swift
./validation-test/compiler_crashers_2_fixed/0100-sr4295.swift
./validation-test/compiler_crashers_2_fixed/0075-rdar30248571.swift
./validation-test/compiler_crashers_2_fixed/0180-sr9022.swift
./validation-test/compiler_crashers_2_fixed/0078-sr4059.swift
./validation-test/compiler_crashers_2_fixed/0080-rdar30442622.swift
./validation-test/compiler_crashers_2_fixed/0045-sr3267.swift
./validation-test/compiler_crashers_2_fixed/0125-rdar33575781.swift
./validation-test/compiler_crashers_2_fixed/0203-sr11149.swift
./validation-test/compiler_crashers_2_fixed/sr8467-2-invalid-read-get-extra-info.swift
./validation-test/compiler_crashers_2_fixed/0002-rdar19792768.swift
./validation-test/compiler_crashers_2_fixed/0119-rdar33613329.swift
./validation-test/compiler_crashers_2_fixed/0053-sr490.swift
./validation-test/compiler_crashers_2_fixed/0115-sr5601.swift
./validation-test/compiler_crashers_2_fixed/0023-rdar21679169.swift
./validation-test/compiler_crashers_2_fixed/0072-sr3895-2.swift
./validation-test/compiler_crashers_2_fixed/0042-rdar21775089.swift
./validation-test/compiler_crashers_2_fixed/0109-sr4737.swift
./validation-test/compiler_crashers_2_fixed/0189-rdar49371608.swift
./validation-test/compiler_crashers_2_fixed/0054-sr833.swift
./validation-test/compiler_crashers_2_fixed/rdar57003317.swift
./validation-test/compiler_crashers_2_fixed/0001-rdar19792730.swift
./validation-test/compiler_crashers_2_fixed/0041-walkToDeclPost-crash.swift
./validation-test/compiler_crashers_2_fixed/0090-emit-implied-witness-table-ref.swift
./validation-test/compiler_crashers_2_fixed/0116-rdar33365139.swift
./validation-test/compiler_crashers_2_fixed/rdar35441779.swift
./validation-test/compiler_crashers_2_fixed/sr12990.swift
./validation-test/compiler_crashers_2_fixed/0050-sr3159.swift
./validation-test/compiler_crashers_2_fixed/0117-rdar33433087.swift
./validation-test/compiler_crashers_2_fixed/0092-se-0154.swift
./validation-test/compiler_crashers_2_fixed/sr12723.swift
./validation-test/compiler_crashers_2_fixed/0096-sr4272.swift
./validation-test/compiler_crashers_2_fixed/0130-sr5013.swift
./validation-test/compiler_crashers_2_fixed/0081-rdar30751491.swift
./validation-test/compiler_crashers_2_fixed/0073-sr2796.swift
./validation-test/compiler_crashers_2_fixed/0150-rdar39055736.swift
./validation-test/compiler_crashers_2_fixed/0019-rdar21511651.swift
./validation-test/compiler_crashers_2_fixed/0141-rdar36989792.swift
./validation-test/compiler_crashers_2_fixed/0083-rdar31163470-1.swift
./validation-test/compiler_crashers_2_fixed/0015-rdar16803384.swift
./validation-test/compiler_crashers_2_fixed/0195-sr10438.swift
./validation-test/compiler_crashers_2_fixed/0145-sr7097.swift
./validation-test/compiler_crashers_2_fixed/0142-rdar36549499.swift
./validation-test/compiler_crashers_2_fixed/0094-rdar30689883.swift
./validation-test/compiler_crashers_2_fixed/0138-rdar36453271.swift
./validation-test/compiler_crashers_2_fixed/0008-rdar18796397.swift
./validation-test/compiler_crashers_2_fixed/0185-sr9017.swift
./validation-test/compiler_crashers_2_fixed/0056-sr3326.swift
./validation-test/compiler_crashers_2_fixed/0206-rdar54952911.swift
./validation-test/compiler_crashers_2_fixed/0139-rdar36278079.swift
./validation-test/compiler_crashers_2_fixed/0065-sr3706.swift
./validation-test/compiler_crashers_2_fixed/0089-sr4458.swift
./validation-test/compiler_crashers_2_fixed/rdar56700017.swift
./validation-test/compiler_crashers_2_fixed/0154-sr7457.swift
./validation-test/compiler_crashers_2_fixed/sr11509.swift
./validation-test/compiler_crashers_2_fixed/0194-rdar50309503.swift
./validation-test/compiler_crashers_2_fixed/0035-rdar22003613.swift
./validation-test/compiler_crashers_2_fixed/sr7002.swift
./validation-test/compiler_crashers_2_fixed/sr9849.swift
./validation-test/compiler_crashers_2_fixed/rdar60081992.swift
./validation-test/compiler_crashers_2_fixed/0197-sr9015.swift
./validation-test/compiler_crashers_2_fixed/0128-rdar35088384.swift
./validation-test/compiler_crashers_2_fixed/28872-rdar45583135.swift
./validation-test/compiler_crashers_2_fixed/sr11637.swift
./validation-test/compiler_crashers_2_fixed/0169-rdar42448618.swift
./validation-test/compiler_crashers_2_fixed/0196-sr9954.swift
./validation-test/compiler_crashers_2_fixed/0199-rdar52679284.swift
./validation-test/compiler_crashers_2_fixed/0202-rdar53183030.swift
./validation-test/compiler_crashers_2_fixed/0113-rdar33044867.swift
./validation-test/compiler_crashers_2_fixed/0182-rdar45680857.swift
./validation-test/compiler_crashers_2_fixed/sr8467-0-invalid-read-get-extra-info.swift
./validation-test/compiler_crashers_2_fixed/0047-sr1307.swift
./validation-test/compiler_crashers_2_fixed/0205-rdar54321473.swift
./validation-test/compiler_crashers_2_fixed/sr10146.swift
./validation-test/compiler_crashers_2_fixed/0085-rdar31000248.swift
./validation-test/compiler_crashers_2_fixed/sr8467-3-invalid-read-get-extra-info.swift
./validation-test/compiler_crashers_2_fixed/0201-rdar53120878.swift
./validation-test/compiler_crashers_2_fixed/0138-rdar36449760.swift
./validation-test/compiler_crashers_2_fixed/sr11085.swift
./validation-test/compiler_crashers_2_fixed/0166-sr8240-2.swift
./validation-test/compiler_crashers_2_fixed/sr-4571.swift
./validation-test/compiler_crashers_2_fixed/0013-rdar19519590.swift
./validation-test/compiler_crashers_2_fixed/0165-sr5427.swift
./validation-test/compiler_crashers_2_fixed/0022-rdar21625478.swift
./validation-test/compiler_crashers_2_fixed/0176-sr-8094.swift
./validation-test/compiler_crashers_2_fixed/0177-rdar-33093935.swift
./validation-test/compiler_crashers_2_fixed/0036-rdar23719809.swift
./validation-test/compiler_crashers_2_fixed/0102-sr4575.swift
./validation-test/compiler_crashers_2_fixed/0063-rdar29782437.swift
./validation-test/compiler_crashers_2_fixed/0064-rdar27627862.swift
./validation-test/compiler_crashers_2_fixed/0159-rdar40009245.swift
./validation-test/compiler_crashers_2_fixed/0137-sr6730.swift
./validation-test/compiler_crashers_2_fixed/0076-sr3500.swift
./validation-test/compiler_crashers_2_fixed/0055-sr3137.swift
./validation-test/compiler_crashers_2_fixed/0086-sr4301.swift
./validation-test/compiler_crashers_2_fixed/0190-rdar48852402.swift
./validation-test/compiler_crashers_2_fixed/0028-rdar19686707.swift
./validation-test/compiler_crashers_2_fixed/0044-enum-dot-crash.swift
./validation-test/compiler_crashers_2_fixed/0143-rdar35870863.swift
./validation-test/compiler_crashers_2_fixed/0144-sr7072.swift
./validation-test/compiler_crashers_2_fixed/0006-rdar20588474.swift
./validation-test/compiler_crashers_2_fixed/0207-rdar55502661.swift
./validation-test/compiler_crashers_2_fixed/0123-rdar31164540.swift
./validation-test/compiler_crashers_2_fixed/0130-rdar35632543.swift
./validation-test/compiler_crashers_2_fixed/0088-sr4315.swift
./validation-test/compiler_crashers_2_fixed/rdar56116278.swift
./validation-test/compiler_crashers_2_fixed/0135-rdar26140749.swift
./validation-test/compiler_crashers_2_fixed/0209-rdar45590743.swift
./validation-test/compiler_crashers_2_fixed/sr8968.swift
./validation-test/compiler_crashers_2_fixed/0091-rdar30168645.swift
./validation-test/compiler_crashers_2_fixed/0030-rdar19534837.swift
./validation-test/compiler_crashers_2_fixed/0192-rdar39826863.swift
./validation-test/compiler_crashers_2_fixed/0146-rdar38309176.swift
./validation-test/compiler_crashers_2_fixed/sr5330.swift
./validation-test/compiler_crashers_2_fixed/0171-sr-8642.swift
./validation-test/compiler_crashers_2_fixed/0083-rdar31163470-2.swift
./validation-test/compiler_crashers_2_fixed/0194-rdar49731284.swift
./validation-test/compiler_crashers_2_fixed/0082-rdar30354669.swift
./validation-test/compiler_crashers_2_fixed/rdar54394068.swift
./validation-test/compiler_crashers_2_fixed/0148-rdar35773761.swift
./validation-test/compiler_crashers_2_fixed/0052-sr3478.swift
./validation-test/compiler_crashers_2_fixed/0025-rdar21783334.swift
./validation-test/compiler_crashers_2_fixed/sr11939.swift
./validation-test/compiler_crashers_2_fixed/0101-sr5014.swift
./validation-test/compiler_crashers_2_fixed/0167-rdar39059582.swift
./validation-test/compiler_crashers_2_fixed/0014-rdar20508671.swift
./validation-test/compiler_crashers_2_fixed/0011-rdar20985062.swift
./validation-test/compiler_crashers_2_fixed/0068-sr3853.swift
./validation-test/compiler_crashers_2_fixed/0163-sr8033.swift
./validation-test/compiler_crashers_2_fixed/0058-rdar29223240.swift
./validation-test/compiler_crashers_2_fixed/sr10201.swift
./validation-test/compiler_crashers_2_fixed/sr11052-typealias.swift
./validation-test/compiler_crashers_2_fixed/0107-rdar32700180.swift
./validation-test/compiler_crashers_2_fixed/0126-sr5905.swift
./validation-test/compiler_crashers_2_fixed/0038-lowering-CheckedCastEmitter-emitConditional.swift
./validation-test/compiler_crashers_2_fixed/Inputs
./validation-test/compiler_crashers_2_fixed/Inputs/0177-rdar-33093935-other.swift
./validation-test/compiler_crashers_2_fixed/Inputs/0068-sr3853
./validation-test/compiler_crashers_2_fixed/Inputs/0068-sr3853/BaseLib.h
./validation-test/compiler_crashers_2_fixed/Inputs/0068-sr3853/other.swift
./validation-test/compiler_crashers_2_fixed/Inputs/0068-sr3853/module.modulemap
./validation-test/compiler_crashers_2_fixed/Inputs/sr9225-other.swift
./validation-test/compiler_crashers_2_fixed/Inputs/sr9583-other.swift
./validation-test/compiler_crashers_2_fixed/Inputs/0178-rdar-45060773-other.swift
./validation-test/compiler_crashers_2_fixed/Inputs/0208-rdar55864759-protocol.swift
./validation-test/compiler_crashers_2_fixed/Inputs/sr5330
./validation-test/compiler_crashers_2_fixed/Inputs/sr5330/ObjCPart.h
./validation-test/compiler_crashers_2_fixed/Inputs/sr5330/module.modulemap
./validation-test/compiler_crashers_2_fixed/0158-rdar40165062.swift
./validation-test/compiler_crashers_2_fixed/0049-sr2611.swift
./validation-test/compiler_crashers_2_fixed/0155-sr7364.swift
./validation-test/compiler_crashers_2_fixed/sr8467-1-invalid-read-get-extra-info.swift
./validation-test/execution
./validation-test/execution/interpret-with-dependencies.swift
./validation-test/execution/interpret-with-dependencies-linux.swift
./validation-test/execution/arc_36509461.swift
./validation-test/execution/dsohandle-multi-module.swift
./validation-test/execution/sr9624.swift
./validation-test/execution/testability.swift
./validation-test/execution/Inputs
./validation-test/execution/Inputs/arc_36509461.h
./validation-test/execution/Inputs/dsohandle-first.swift
./validation-test/execution/Inputs/dsohandle-second.swift
./validation-test/execution/Inputs/custom-modules
./validation-test/execution/Inputs/custom-modules/foo.h
./validation-test/execution/Inputs/custom-modules/module.modulemap
./validation-test/execution/Inputs/arc_36509461.m
./validation-test/Evolution
./validation-test/Evolution/test_class_add_convenience_init.swift
./validation-test/Evolution/test_class_resilient_add_virtual_method_subclass.swift
./validation-test/Evolution/test_struct_change_stored_to_computed_static.swift
./validation-test/Evolution/test_keypath_default_argument.swift
./validation-test/Evolution/test_enum_reorder_cases.swift
./validation-test/Evolution/test_enum_change_size.swift
./validation-test/Evolution/test_struct_change_size.swift
./validation-test/Evolution/test_struct_remove_property.swift
./validation-test/Evolution/test_struct_resilient_remove_conformance.swift
./validation-test/Evolution/test_class_resilient_superclass_properties.swift
./validation-test/Evolution/test_global_stored_to_computed.swift
./validation-test/Evolution/test_class_fixed_layout_add_virtual_method.swift
./validation-test/Evolution/test_global_change_size.swift
./validation-test/Evolution/test_struct_add_property.swift
./validation-test/Evolution/test_backward_deploy_struct.swift
./validation-test/Evolution/test_backward_deploy_conformance.swift
./validation-test/Evolution/test_backward_deploy_top_level.swift
./validation-test/Evolution/test_struct_resilient_add_conformance.swift
./validation-test/Evolution/test_class_add_property_subclass.swift
./validation-test/Evolution/test_class_change_stored_to_computed.swift
./validation-test/Evolution/test_class_change_lazy_to_computed.swift
./validation-test/Evolution/test_class_add_property_attribute.swift
./validation-test/Evolution/test_struct_change_stored_to_computed.swift
./validation-test/Evolution/test_function_change_transparent_body.swift
./validation-test/Evolution/test_protocol_reorder_requirements.swift
./validation-test/Evolution/test_class_resilient_superclass_reorder_methods.swift
./validation-test/Evolution/README.md
./validation-test/Evolution/test_struct_add_property_attribute.swift
./validation-test/Evolution/test_class_resilient_superclass_methods.swift
./validation-test/Evolution/test_class_remove_property.swift
./validation-test/Evolution/test_backward_deploy_class.swift
./validation-test/Evolution/test_struct_add_initializer.swift
./validation-test/Evolution/test_class_resilient_add_virtual_method.swift
./validation-test/Evolution/test_change_default_argument_to_magic.swift
./validation-test/Evolution/test_class_fixed_layout_add_virtual_method_subclass.swift
./validation-test/Evolution/test_class_change_stored_to_observed.swift
./validation-test/Evolution/test_bitwise_takable.swift
./validation-test/Evolution/test_move_method_to_extension.swift
./validation-test/Evolution/test_class_add_deinit.swift
./validation-test/Evolution/test_class_resilient_add_override.swift
./validation-test/Evolution/test_struct_change_stored_to_observed.swift
./validation-test/Evolution/test_keypaths.swift.gyb
./validation-test/Evolution/test_class_insert_superclass.swift
./validation-test/Evolution/test_struct_static_stored_to_computed.swift
./validation-test/Evolution/test_struct_fixed_layout_add_conformance.swift
./validation-test/Evolution/test_protocol_add_requirements.swift
./validation-test/Evolution/test_class_fixed_layout_superclass_reorder_methods.swift
./validation-test/Evolution/test_struct_fixed_layout_remove_conformance.swift
./validation-test/Evolution/test_rth.swift
./validation-test/Evolution/test_conformance_reference.swift
./validation-test/Evolution/test_enum_add_cases.swift
./validation-test/Evolution/test_class_change_size.swift
./validation-test/Evolution/test_opaque_archetypes_change_underlying_type.swift
./validation-test/Evolution/test_enum_add_cases_trap.swift
./validation-test/Evolution/test_generic_resilient_struct_add_property.swift
./validation-test/Evolution/test_backward_deploy_protocol.swift
./validation-test/Evolution/test_backward_deploy_always_emit_into_client.swift
./validation-test/Evolution/Inputs
./validation-test/Evolution/Inputs/protocol_add_requirements.swift
./validation-test/Evolution/Inputs/class_resilient_superclass_reorder_methods.swift
./validation-test/Evolution/Inputs/class_add_property.swift
./validation-test/Evolution/Inputs/struct_add_initializer.swift
./validation-test/Evolution/Inputs/conformance_reference.swift
./validation-test/Evolution/Inputs/keypaths_gyb.py
./validation-test/Evolution/Inputs/class_insert_superclass.swift
./validation-test/Evolution/Inputs/struct_resilient_add_conformance.swift
./validation-test/Evolution/Inputs/enum_add_cases_trap.swift
./validation-test/Evolution/Inputs/class_resilient_add_virtual_method.swift
./validation-test/Evolution/Inputs/class_change_stored_to_computed.swift
./validation-test/Evolution/Inputs/rth.swift
./validation-test/Evolution/Inputs/class_change_lazy_to_computed.swift
./validation-test/Evolution/Inputs/struct_change_stored_to_computed.swift
./validation-test/Evolution/Inputs/function_change_transparent_body.swift
./validation-test/Evolution/Inputs/class_add_property_attribute.swift
./validation-test/Evolution/Inputs/keypath_default_argument.swift
./validation-test/Evolution/Inputs/enum_add_cases.swift
./validation-test/Evolution/Inputs/protocol_reorder_requirements.swift
./validation-test/Evolution/Inputs/class_resilient_superclass_methods.swift
./validation-test/Evolution/Inputs/backward_deploy_class.swift
./validation-test/Evolution/Inputs/backward_deploy_always_emit_into_client.swift
./validation-test/Evolution/Inputs/keypaths.swift.gyb
./validation-test/Evolution/Inputs/enum_change_size.swift
./validation-test/Evolution/Inputs/struct_resilient_remove_conformance.swift
./validation-test/Evolution/Inputs/class_resilient_superclass_properties.swift
./validation-test/Evolution/Inputs/class_remove_property.swift
./validation-test/Evolution/Inputs/class_fixed_layout_add_virtual_method.swift
./validation-test/Evolution/Inputs/bitwise_takable.swift
./validation-test/Evolution/Inputs/class_change_size.swift
./validation-test/Evolution/Inputs/global_stored_to_computed.swift
./validation-test/Evolution/Inputs/struct_change_lazy_to_computed.swift
./validation-test/Evolution/Inputs/struct_remove_property.swift
./validation-test/Evolution/Inputs/class_resilient_add_virtual_method_subclass.swift
./validation-test/Evolution/Inputs/class_change_stored_to_observed.swift
./validation-test/Evolution/Inputs/backward_deploy_conformance.swift
./validation-test/Evolution/Inputs/class_add_convenience_init.swift
./validation-test/Evolution/Inputs/global_change_size.swift
./validation-test/Evolution/Inputs/backward_deploy_enum.swift
./validation-test/Evolution/Inputs/class_resilient_add_override.swift
./validation-test/Evolution/Inputs/opaque_archetypes_change_underlying_type.swift
./validation-test/Evolution/Inputs/struct_change_stored_to_computed_static.swift
./validation-test/Evolution/Inputs/struct_fixed_layout_remove_conformance.swift
./validation-test/Evolution/Inputs/struct_change_stored_to_observed.swift
./validation-test/Evolution/Inputs/class_fixed_layout_superclass_reorder_methods.swift
./validation-test/Evolution/Inputs/backward_deploy_top_level.swift
./validation-test/Evolution/Inputs/struct_add_property_attribute.swift
./validation-test/Evolution/Inputs/backward_deploy_protocol.swift
./validation-test/Evolution/Inputs/class_add_property_subclass.swift
./validation-test/Evolution/Inputs/change_default_argument_to_magic.swift
./validation-test/Evolution/Inputs/generic_resilient_struct_add_property.swift
./validation-test/Evolution/Inputs/class_fixed_layout_add_virtual_method_subclass.swift
./validation-test/Evolution/Inputs/struct_change_size.swift
./validation-test/Evolution/Inputs/enum_reorder_cases.swift
./validation-test/Evolution/Inputs/struct_add_property.swift
./validation-test/Evolution/Inputs/struct_static_stored_to_computed.swift
./validation-test/Evolution/Inputs/move_method_to_extension.swift
./validation-test/Evolution/Inputs/backward_deploy_struct.swift
./validation-test/Evolution/Inputs/struct_fixed_layout_add_conformance.swift
./validation-test/Evolution/Inputs/class_add_deinit.swift
./validation-test/Evolution/test_struct_change_lazy_to_computed.swift
./validation-test/Evolution/test_backward_deploy_enum.swift
./validation-test/Evolution/test_class_add_property.swift
./validation-test/lit.cfg
./validation-test/compiler_scale
./validation-test/compiler_scale/array_init.swift.gyb
./validation-test/compiler_scale/nominal_bodies.gyb
./validation-test/compiler_scale/parse_array_nested.swift.gyb
./validation-test/compiler_scale/callee_analysis_invalidation.gyb
./validation-test/compiler_scale/used_conformances.gyb
./validation-test/compiler_scale/protocol_members.gyb
./validation-test/compiler_scale/bind_extension_decl.gyb
./validation-test/compiler_scale/bind_nested_extension_decl.gyb
./validation-test/compiler_scale/struct_nested.gyb
./validation-test/compiler_scale/class_members.gyb
./validation-test/compiler_scale/dynamic_lookup.gyb
./validation-test/compiler_scale/scale_neighbouring_getset.gyb
./validation-test/compiler_scale/lazy_class_props.gyb
./validation-test/compiler_scale/struct_members.gyb
./validation-test/compiler_scale/enum_indirect.gyb
./validation-test/compiler_scale/var_decl_usage_checker.swift.gyb
./validation-test/compiler_scale/enum_members.gyb
./validation-test/compiler_scale/dynamic_lookup_2.swift
./validation-test/compiler_scale/function_bodies.gyb
./validation-test/test-runner
./validation-test/test-runner/NonZeroExitCodeIsFailure.swift
./validation-test/test-runner/AbortIsFailure.swift
./validation-test/stdlib
./validation-test/stdlib/Arrays.swift.gyb
./validation-test/stdlib/BoolDiagnostics.swift
./validation-test/stdlib/SetAnyHashableExtensions.swift
./validation-test/stdlib/GameplayKit.swift
./validation-test/stdlib/Random.swift
./validation-test/stdlib/SequenceType.swift.gyb
./validation-test/stdlib/ComplexOperators.swift
./validation-test/stdlib/ObjectiveC_without_Foundation.swift
./validation-test/stdlib/ModelIO.swift
./validation-test/stdlib/CollectionCasts.swift.gyb
./validation-test/stdlib/ArrayBridging.swift
./validation-test/stdlib/CUUID.swift
./validation-test/stdlib/Collection
./validation-test/stdlib/Collection/DefaultedMutableRangeReplaceableRandomAccessCollectionOfRef.swift
./validation-test/stdlib/Collection/MinimalMutableRangeReplaceableBidirectionalCollection.swift
./validation-test/stdlib/Collection/DefaultedMutableCollection.swift
./validation-test/stdlib/Collection/LazyFilterCollection.swift.gyb
./validation-test/stdlib/Collection/MinimalRandomAccessCollection.swift
./validation-test/stdlib/Collection/DefaultedRandomAccessCollection.swift
./validation-test/stdlib/Collection/MinimalBidirectionalCollectionOfRef.swift
./validation-test/stdlib/Collection/MinimalMutableRandomAccessCollection.swift
./validation-test/stdlib/Collection/LazyMapCollection.swift
./validation-test/stdlib/Collection/MinimalMutableRangeReplaceableRandomAccessCollectionOfRef.swift
./validation-test/stdlib/Collection/MinimalMutableRangeReplaceableRandomAccessCollection.swift
./validation-test/stdlib/Collection/MinimalMutableRangeReplaceableCollection.swift
./validation-test/stdlib/Collection/DefaultedMutableRangeReplaceableBidirectionalCollection.swift
./validation-test/stdlib/Collection/MinimalMutableRangeReplaceableCollectionOfRef.swift
./validation-test/stdlib/Collection/DefaultedMutableRangeReplaceableBidirectionalCollectionOfRef.swift
./validation-test/stdlib/Collection/MinimalRangeReplaceableBidirectionalCollection.swift
./validation-test/stdlib/Collection/MinimalBidirectionalCollection.swift
./validation-test/stdlib/Collection/DefaultedBidirectionalCollection.swift
./validation-test/stdlib/Collection/MinimalCollectionOfRef.swift
./validation-test/stdlib/Collection/DefaultedRangeReplaceableRandomAccessCollection.swift
./validation-test/stdlib/Collection/MinimalRangeReplaceableCollectionOfRef.swift
./validation-test/stdlib/Collection/MinimalRangeReplaceableRandomAccessCollectionOfRef.swift
./validation-test/stdlib/Collection/DefaultedMutableRangeReplaceableCollectionOfRef.swift
./validation-test/stdlib/Collection/MinimalRangeReplaceableCollection.swift
./validation-test/stdlib/Collection/DefaultedCollection.swift
./validation-test/stdlib/Collection/LazyMapSequence.swift
./validation-test/stdlib/Collection/LazyMapBidirectionalCollection.swift
./validation-test/stdlib/Collection/MinimalMutableCollection.swift
./validation-test/stdlib/Collection/DefaultedRangeReplaceableRandomAccessCollectionOfRef.swift
./validation-test/stdlib/Collection/DefaultedMutableRandomAccessCollection.swift
./validation-test/stdlib/Collection/DefaultedMutableBidirectionalCollectionOfRef.swift
./validation-test/stdlib/Collection/LazyMapRandomAccessCollection.swift
./validation-test/stdlib/Collection/MinimalRangeReplaceableRandomAccessCollection.swift
./validation-test/stdlib/Collection/MinimalMutableRandomAccessCollectionOfRef.swift
./validation-test/stdlib/Collection/MinimalRandomAccessCollectionOfRef.swift
./validation-test/stdlib/Collection/DefaultedMutableCollectionOfRef.swift
./validation-test/stdlib/Collection/MinimalMutableCollectionOfRef.swift
./validation-test/stdlib/Collection/DefaultedMutableRandomAccessCollectionOfRef.swift
./validation-test/stdlib/Collection/DefaultedMutableRangeReplaceableRandomAccessCollection.swift
./validation-test/stdlib/Collection/DefaultedMutableRangeReplaceableCollection.swift
./validation-test/stdlib/Collection/DefaultedRangeReplaceableBidirectionalCollection.swift
./validation-test/stdlib/Collection/MinimalMutableRangeReplaceableBidirectionalCollectionOfRef.swift
./validation-test/stdlib/Collection/DefaultedCollectionOfRef.swift
./validation-test/stdlib/Collection/DefaultedRangeReplaceableCollection.swift
./validation-test/stdlib/Collection/DefaultedBidirectionalCollectionOfRef.swift
./validation-test/stdlib/Collection/MinimalMutableBidirectionalCollectionOfRef.swift
./validation-test/stdlib/Collection/DefaultedRandomAccessCollectionOfRef.swift
./validation-test/stdlib/Collection/MinimalMutableBidirectionalCollection.swift
./validation-test/stdlib/Collection/FlattenCollection.swift.gyb
./validation-test/stdlib/Collection/MinimalCollection.swift
./validation-test/stdlib/Collection/DefaultedRangeReplaceableCollectionOfRef.swift
./validation-test/stdlib/Collection/DefaultedRangeReplaceableBidirectionalCollectionOfRef.swift
./validation-test/stdlib/Collection/Inputs
./validation-test/stdlib/Collection/Inputs/Template.swift.gyb
./validation-test/stdlib/Collection/Inputs/LazyMapTemplate.swift.gyb
./validation-test/stdlib/Collection/MinimalRangeReplaceableBidirectionalCollectionOfRef.swift
./validation-test/stdlib/Collection/DefaultedMutableBidirectionalCollection.swift
./validation-test/stdlib/ParameterPassing.swift.gyb
./validation-test/stdlib/DictionaryAnyHashableExtensions.swift
./validation-test/stdlib/StringBreadcrumbs.swift
./validation-test/stdlib/Assert.swift
./validation-test/stdlib/Array.swift.gyb
./validation-test/stdlib/CharacterPropertiesLong.swift
./validation-test/stdlib/Join.swift.gyb
./validation-test/stdlib/Data.swift
./validation-test/stdlib/CommandLine.swift
./validation-test/stdlib/ErrorProtocol.swift
./validation-test/stdlib/StringViews.swift
./validation-test/stdlib/ArrayNew.swift.gyb
./validation-test/stdlib/UnsafeBufferPointer.swift.gyb
./validation-test/stdlib/AssertDiagnosticsSIL.swift
./validation-test/stdlib/FixedPointArithmeticTraps.swift.gyb
./validation-test/stdlib/NumericDiagnostics.swift.gyb
./validation-test/stdlib/CollectionCompatibility.swift
./validation-test/stdlib/Array
./validation-test/stdlib/Array/ContiguousArray_MutableRandomAccessCollectionRef.swift
./validation-test/stdlib/Array/ArraySlice_RangeReplaceableRandomAccessCollectionRef.swift
./validation-test/stdlib/Array/Array_MutableRandomAccessCollectionVal.swift
./validation-test/stdlib/Array/ArraySliceWithNonZeroStartIndex_RangeReplaceableRandomAccessCollectionVal.swift
./validation-test/stdlib/Array/Array_MutableRandomAccessCollectionRef.swift
./validation-test/stdlib/Array/ArraySliceWithNonZeroStartIndex_RangeReplaceableRandomAccessCollectionRef.swift
./validation-test/stdlib/Array/ArraySlice_RangeReplaceableRandomAccessCollectionVal.swift
./validation-test/stdlib/Array/ContiguousArray_MutableRandomAccessCollectionVal.swift
./validation-test/stdlib/Array/ArraySlice_MutableRandomAccessCollectionVal.swift
./validation-test/stdlib/Array/ContiguousArray_RangeReplaceableRandomAccessCollectionVal.swift
./validation-test/stdlib/Array/ArraySliceWithNonZeroStartIndex_MutableRandomAccessCollectionVal.swift
./validation-test/stdlib/Array/Array_RangeReplaceableRandomAccessCollectionVal.swift
./validation-test/stdlib/Array/Array_RangeReplaceableRandomAccessCollectionRef.swift
./validation-test/stdlib/Array/ArraySliceWithNonZeroStartIndex_MutableRandomAccessCollectionRef.swift
./validation-test/stdlib/Array/ContiguousArray_RangeReplaceableRandomAccessCollectionRef.swift
./validation-test/stdlib/Array/ArraySlice_MutableRandomAccessCollectionRef.swift
./validation-test/stdlib/Array/Inputs
./validation-test/stdlib/Array/Inputs/ArrayConformanceTests.swift.gyb
./validation-test/stdlib/Generator.swift
./validation-test/stdlib/DictionaryTrapsObjC.swift
./validation-test/stdlib/Glibc.swift
./validation-test/stdlib/CollectionOld.swift
./validation-test/stdlib/UnicodeTrieGenerator.gyb
./validation-test/stdlib/Slice.swift.gyb
./validation-test/stdlib/XCTest.swift
./validation-test/stdlib/Slice
./validation-test/stdlib/Slice/Slice_Of_DefaultedCollection_WithPrefix.swift
./validation-test/stdlib/Slice/Slice_Of_DefaultedRandomAccessCollection_WithPrefix.swift
./validation-test/stdlib/Slice/Slice_Of_DefaultedCollection_WithPrefixAndSuffix.swift
./validation-test/stdlib/Slice/Slice_Of_MinimalMutableRangeReplaceableBidirectionalCollection_WithPrefixAndSuffix.swift
./validation-test/stdlib/Slice/Slice_Of_MinimalRangeReplaceableBidirectionalCollection_WithPrefix.swift
./validation-test/stdlib/Slice/Slice_Of_DefaultedRangeReplaceableBidirectionalCollection_WithSuffix.swift
./validation-test/stdlib/Slice/Slice_Of_DefaultedMutableCollection_WithSuffix.swift
./validation-test/stdlib/Slice/Slice_Of_DefaultedMutableRangeReplaceableCollection_FullWidth.swift
./validation-test/stdlib/Slice/Slice_Of_DefaultedMutableRangeReplaceableRandomAccessCollection_FullWidth.swift
./validation-test/stdlib/Slice/Slice_Of_MinimalRangeReplaceableBidirectionalCollection_WithSuffix.swift
./validation-test/stdlib/Slice/Slice_Of_DefaultedRangeReplaceableBidirectionalCollection_FullWidth.swift
./validation-test/stdlib/Slice/Slice_Of_DefaultedMutableRandomAccessCollection_WithPrefixAndSuffix.swift
./validation-test/stdlib/Slice/Slice_Of_DefaultedMutableRangeReplaceableBidirectionalCollection_WithPrefixAndSuffix.swift
./validation-test/stdlib/Slice/Slice_Of_DefaultedRangeReplaceableBidirectionalCollection_WithPrefix.swift
./validation-test/stdlib/Slice/Slice_Of_MinimalMutableCollection_WithPrefixAndSuffix.swift
./validation-test/stdlib/Slice/Slice_Of_MinimalMutableRangeReplaceableBidirectionalCollection_FullWidth.swift
./validation-test/stdlib/Slice/Slice_Of_DefaultedMutableCollection_WithPrefix.swift
./validation-test/stdlib/Slice/Slice_Of_DefaultedCollection_WithSuffix.swift
./validation-test/stdlib/Slice/Slice_Of_DefaultedRangeReplaceableBidirectionalCollection_WithPrefixAndSuffix.swift
./validation-test/stdlib/Slice/Slice_Of_DefaultedMutableRangeReplaceableBidirectionalCollection_FullWidth.swift
./validation-test/stdlib/Slice/Slice_Of_DefaultedRandomAccessCollection_WithSuffix.swift
./validation-test/stdlib/Slice/Slice_Of_MinimalMutableBidirectionalCollection_WithPrefixAndSuffix.swift
./validation-test/stdlib/Slice/Slice_Of_MinimalMutableRandomAccessCollection_WithSuffix.swift
./validation-test/stdlib/Slice/Slice_Of_MinimalMutableRangeReplaceableBidirectionalCollection_WithPrefix.swift
./validation-test/stdlib/Slice/Slice_Of_DefaultedRandomAccessCollection_FullWidth.swift
./validation-test/stdlib/Slice/Slice_Of_MinimalRangeReplaceableCollection_WithPrefixAndSuffix.swift
./validation-test/stdlib/Slice/Slice_Of_MinimalBidirectionalCollection_WithSuffix.swift
./validation-test/stdlib/Slice/Slice_Of_DefaultedBidirectionalCollection_WithSuffix.swift
./validation-test/stdlib/Slice/Slice_Of_DefaultedMutableRangeReplaceableCollection_WithPrefix.swift
./validation-test/stdlib/Slice/Slice_Of_DefaultedRangeReplaceableCollection_WithPrefix.swift
./validation-test/stdlib/Slice/Slice_Of_DefaultedRangeReplaceableCollection_WithPrefixAndSuffix.swift
./validation-test/stdlib/Slice/Slice_Of_DefaultedRangeReplaceableRandomAccessCollection_WithPrefixAndSuffix.swift
./validation-test/stdlib/Slice/Slice_Of_DefaultedMutableBidirectionalCollection_FullWidth.swift
./validation-test/stdlib/Slice/Slice_Of_MinimalRangeReplaceableBidirectionalCollection_FullWidth.swift
./validation-test/stdlib/Slice/Slice_Of_MinimalMutableRandomAccessCollection_WithPrefixAndSuffix.swift
./validation-test/stdlib/Slice/Slice_Of_MinimalBidirectionalCollection_WithPrefix.swift
./validation-test/stdlib/Slice/Slice_Of_DefaultedMutableRangeReplaceableCollection_WithSuffix.swift
./validation-test/stdlib/Slice/Slice_Of_DefaultedBidirectionalCollection_WithPrefix.swift
./validation-test/stdlib/Slice/Slice_Of_MinimalBidirectionalCollection_FullWidth.swift
./validation-test/stdlib/Slice/Slice_Of_DefaultedRangeReplaceableCollection_WithSuffix.swift
./validation-test/stdlib/Slice/Slice_Of_MinimalMutableRangeReplaceableCollection_FullWidth.swift
./validation-test/stdlib/Slice/Slice_Of_MinimalMutableRandomAccessCollection_WithPrefix.swift
./validation-test/stdlib/Slice/Slice_Of_DefaultedMutableBidirectionalCollection_WithPrefixAndSuffix.swift
./validation-test/stdlib/Slice/Slice_Of_MinimalMutableRangeReplaceableBidirectionalCollection_WithSuffix.swift
./validation-test/stdlib/Slice/Slice_Of_MinimalRangeReplaceableRandomAccessCollection_FullWidth.swift
./validation-test/stdlib/Slice/Slice_Of_MinimalCollection_FullWidth.swift
./validation-test/stdlib/Slice/Slice_Of_DefaultedRangeReplaceableRandomAccessCollection_WithSuffix.swift
./validation-test/stdlib/Slice/Slice_Of_DefaultedMutableCollection_WithPrefixAndSuffix.swift
./validation-test/stdlib/Slice/Slice_Of_MinimalMutableRangeReplaceableRandomAccessCollection_WithPrefixAndSuffix.swift
./validation-test/stdlib/Slice/Slice_Of_DefaultedMutableBidirectionalCollection_WithSuffix.swift
./validation-test/stdlib/Slice/Slice_Of_DefaultedCollection_FullWidth.swift
./validation-test/stdlib/Slice/Slice_Of_MinimalMutableRangeReplaceableRandomAccessCollection_WithSuffix.swift
./validation-test/stdlib/Slice/Slice_Of_DefaultedMutableRangeReplaceableBidirectionalCollection_WithPrefix.swift
./validation-test/stdlib/Slice/Slice_Of_MinimalRangeReplaceableBidirectionalCollection_WithPrefixAndSuffix.swift
./validation-test/stdlib/Slice/Slice_Of_DefaultedBidirectionalCollection_FullWidth.swift
./validation-test/stdlib/Slice/Slice_Of_DefaultedMutableRangeReplaceableRandomAccessCollection_WithSuffix.swift
./validation-test/stdlib/Slice/Slice_Of_MinimalMutableCollection_WithSuffix.swift
./validation-test/stdlib/Slice/Slice_Of_MinimalMutableRangeReplaceableCollection_WithPrefixAndSuffix.swift
./validation-test/stdlib/Slice/Slice_Of_DefaultedMutableRangeReplaceableRandomAccessCollection_WithPrefixAndSuffix.swift
./validation-test/stdlib/Slice/Slice_Of_DefaultedMutableRangeReplaceableRandomAccessCollection_WithPrefix.swift
./validation-test/stdlib/Slice/Slice_Of_MinimalRangeReplaceableRandomAccessCollection_WithPrefixAndSuffix.swift
./validation-test/stdlib/Slice/Slice_Of_MinimalMutableCollection_WithPrefix.swift
./validation-test/stdlib/Slice/Slice_Of_MinimalRandomAccessCollection_WithPrefixAndSuffix.swift
./validation-test/stdlib/Slice/Slice_Of_DefaultedRangeReplaceableRandomAccessCollection_FullWidth.swift
./validation-test/stdlib/Slice/Slice_Of_MinimalMutableRangeReplaceableRandomAccessCollection_FullWidth.swift
./validation-test/stdlib/Slice/Slice_Of_DefaultedMutableBidirectionalCollection_WithPrefix.swift
./validation-test/stdlib/Slice/Slice_Of_MinimalRangeReplaceableCollection_FullWidth.swift
./validation-test/stdlib/Slice/Slice_Of_MinimalBidirectionalCollection_WithPrefixAndSuffix.swift
./validation-test/stdlib/Slice/Slice_Of_DefaultedRangeReplaceableRandomAccessCollection_WithPrefix.swift
./validation-test/stdlib/Slice/Slice_Of_DefaultedMutableRangeReplaceableBidirectionalCollection_WithSuffix.swift
./validation-test/stdlib/Slice/Slice_Of_MinimalMutableRangeReplaceableRandomAccessCollection_WithPrefix.swift
./validation-test/stdlib/Slice/Slice_Of_MinimalRangeReplaceableRandomAccessCollection_WithSuffix.swift
./validation-test/stdlib/Slice/Slice_Of_DefaultedBidirectionalCollection_WithPrefixAndSuffix.swift
./validation-test/stdlib/Slice/Slice_Of_DefaultedMutableRandomAccessCollection_WithSuffix.swift
./validation-test/stdlib/Slice/Slice_Of_MinimalRandomAccessCollection_WithSuffix.swift
./validation-test/stdlib/Slice/Slice_Of_MinimalCollection_WithPrefix.swift
./validation-test/stdlib/Slice/Slice_Of_DefaultedRangeReplaceableCollection_FullWidth.swift
./validation-test/stdlib/Slice/Slice_Of_MinimalMutableRandomAccessCollection_FullWidth.swift
./validation-test/stdlib/Slice/Slice_Of_MinimalRangeReplaceableCollection_WithSuffix.swift
./validation-test/stdlib/Slice/Slice_Of_DefaultedRandomAccessCollection_WithPrefixAndSuffix.swift
./validation-test/stdlib/Slice/Slice_Of_MinimalRandomAccessCollection_FullWidth.swift
./validation-test/stdlib/Slice/Slice_Of_MinimalMutableRangeReplaceableCollection_WithSuffix.swift
./validation-test/stdlib/Slice/Slice_Of_MinimalMutableBidirectionalCollection_WithSuffix.swift
./validation-test/stdlib/Slice/Slice_Of_MinimalMutableCollection_FullWidth.swift
./validation-test/stdlib/Slice/Slice_Of_MinimalMutableBidirectionalCollection_WithPrefix.swift
./validation-test/stdlib/Slice/Slice_Of_MinimalMutableRangeReplaceableCollection_WithPrefix.swift
./validation-test/stdlib/Slice/Slice_Of_MinimalMutableBidirectionalCollection_FullWidth.swift
./validation-test/stdlib/Slice/Slice_Of_DefaultedMutableRangeReplaceableCollection_WithPrefixAndSuffix.swift
./validation-test/stdlib/Slice/Slice_Of_MinimalCollection_WithPrefixAndSuffix.swift
./validation-test/stdlib/Slice/Slice_Of_MinimalRangeReplaceableRandomAccessCollection_WithPrefix.swift
./validation-test/stdlib/Slice/Slice_Of_DefaultedMutableRandomAccessCollection_WithPrefix.swift
./validation-test/stdlib/Slice/Slice_Of_DefaultedMutableCollection_FullWidth.swift
./validation-test/stdlib/Slice/Inputs
./validation-test/stdlib/Slice/Inputs/Template.swift.gyb
./validation-test/stdlib/Slice/Slice_Of_DefaultedMutableRandomAccessCollection_FullWidth.swift
./validation-test/stdlib/Slice/Slice_Of_MinimalRandomAccessCollection_WithPrefix.swift
./validation-test/stdlib/Slice/Slice_Of_MinimalCollection_WithSuffix.swift
./validation-test/stdlib/Slice/Slice_Of_MinimalRangeReplaceableCollection_WithPrefix.swift
./validation-test/stdlib/FixedPoint.swift.gyb
./validation-test/stdlib/CollectionType.swift.gyb
./validation-test/stdlib/HashableIndices.swift
./validation-test/stdlib/StringSlicesConcurrentAppend.swift
./validation-test/stdlib/StringNormalization.swift
./validation-test/stdlib/ObjectiveC.swift
./validation-test/stdlib/Lazy.swift.gyb
./validation-test/stdlib/FloatingPointConversion_Release.test-sh
./validation-test/stdlib/HashingRandomization.swift
./validation-test/stdlib/NSDecimalNumberBridging.swift.gyb
./validation-test/stdlib/FixedPointConversion_Release.test-sh
./validation-test/stdlib/Algorithm.swift
./validation-test/stdlib/Unicode.swift.gyb
./validation-test/stdlib/ArraySlice.swift.gyb
./validation-test/stdlib/HashingPrototype.swift
./validation-test/stdlib/CryptoTokenKitTests.swift
./validation-test/stdlib/BoolDiagnostics_Dataflow.swift
./validation-test/stdlib/SetAlgebra.swift
./validation-test/stdlib/FloatingPointConversion_Debug.test-sh
./validation-test/stdlib/AnyHashable.swift.gyb
./validation-test/stdlib/UnicodeLongTest.swift
./validation-test/stdlib/SwiftNativeNSBase.swift
./validation-test/stdlib/Prototypes
./validation-test/stdlib/Prototypes/PersistentVector.swift.gyb
./validation-test/stdlib/Index.swift.gyb
./validation-test/stdlib/ErrorHandling.swift
./validation-test/stdlib/NSStringBridging.swift.gyb
./validation-test/stdlib/SpriteKit.swift
./validation-test/stdlib/CoreData.swift
./validation-test/stdlib/Sort.swift.gyb
./validation-test/stdlib/OptionSet.swift
./validation-test/stdlib/Dictionary.swift
./validation-test/stdlib/FixedPointDiagnostics.swift.gyb
./validation-test/stdlib/SIMDParameterPassing.swift.gyb
./validation-test/stdlib/CollectionDiagnostics.swift
./validation-test/stdlib/Range.swift.gyb
./validation-test/stdlib/UnicodeUTFEncoders.swift
./validation-test/stdlib/CoreGraphics-execute.swift
./validation-test/stdlib/String.swift
./validation-test/stdlib/CoreAudio.swift
./validation-test/stdlib/ValidationNSNumberBridging.swift
./validation-test/stdlib/ExistentialCollection.swift.gyb
./validation-test/stdlib/DictionaryBridging.swift
./validation-test/stdlib/Bitset.swift
./validation-test/stdlib/OpenCLSDKOverlay.swift
./validation-test/stdlib/FixedPointConversion_Debug.test-sh
./validation-test/stdlib/Concatenate.swift
./validation-test/stdlib/CoreGraphics-verifyOnly.swift
./validation-test/stdlib/StringUTF8.swift
./validation-test/stdlib/Bool.swift
./validation-test/stdlib/NewArray.swift.gyb
./validation-test/stdlib/RangeReplaceable.swift.gyb
./validation-test/stdlib/ArrayTrapsObjC.swift
./validation-test/stdlib/WatchKit.swift
./validation-test/stdlib/SipHash.swift
./validation-test/stdlib/Hashing.swift
./validation-test/stdlib/StringLowercasedUppercased.swift
./validation-test/stdlib/SafariServices.swift
./validation-test/stdlib/UnfoldSequence.swift
./validation-test/stdlib/AtomicsDiagnostics.swift
./validation-test/stdlib/SceneKit.swift
./validation-test/stdlib/ContiguousArray.swift.gyb
./validation-test/stdlib/IOKitOverlay.swift
./validation-test/stdlib/MicroStdlib
./validation-test/stdlib/MicroStdlib/MicroStdlib.swift
./validation-test/stdlib/MicroStdlib/Inputs
./validation-test/stdlib/MicroStdlib/Inputs/RuntimeStubs.c
./validation-test/stdlib/MicroStdlib/Inputs/Swift.swift
./validation-test/stdlib/MicroStdlib/Inputs/main.swift
./validation-test/stdlib/HashedCollectionFilter.swift
./validation-test/stdlib/HashingAvalanche.swift
./validation-test/stdlib/Set.swift
./validation-test/stdlib/ArrayTraps.swift.gyb
./validation-test/stdlib/PhotosTests.swift
./validation-test/stdlib/Stride.swift
./validation-test/stdlib/POSIXErrorCode.swift
./validation-test/stdlib/Inputs
./validation-test/stdlib/StringMemoryTest.swift
./validation-test/stdlib/CoreMedia.swift
./validation-test/SIL
./validation-test/SIL/crashers
./validation-test/SIL/crashers/013-swift-parser-parsesilglobal.sil
./validation-test/SIL/crashers/029-swift-parser-parsesilscope.sil
./validation-test/SIL/crashers/015-swift-parser-parsesilwitnesstable.sil
./validation-test/SIL/crashers/009-swift-parser-parsedeclsil.sil
./validation-test/SIL/crashers/002-swift-performnamebinding.sil
./validation-test/SIL/crashers/031-swift-typechecker-configureinterfacetype.sil
./validation-test/SIL/crashers/001-swift-parser-parsesilvtable.sil
./validation-test/SIL/parse_stdlib.sil
./validation-test/SIL/crashers_fixed
./validation-test/SIL/crashers_fixed/011-swift-typechecker-validatetype.sil
./validation-test/SIL/crashers_fixed/036-swift-cantype-isreferencetypeimpl.sil
./validation-test/SIL/crashers_fixed/010-swift-typechecker-addimplicitconstructors.sil
./validation-test/SIL/crashers_fixed/027-swift-nominaltypedecl-getdeclaredtype.sil
./validation-test/SIL/crashers_fixed/020-swift-moduledecl-lookupconformance.sil
./validation-test/SIL/crashers_fixed/019-swift-parser-parseexprpostfix.sil
./validation-test/SIL/crashers_fixed/024-swift-expr-walk.sil
./validation-test/SIL/crashers_fixed/007-swift-abstractstoragedecl-makecomputed.sil
./validation-test/SIL/crashers_fixed/006-swift-syntaxsugartype-getimplementationtype.sil
./validation-test/SIL/crashers_fixed/034-swift-expr-propagatelvalueaccesskind.sil
./validation-test/SIL/crashers_fixed/021-swift-typechecker-typecheckdecl.sil
./validation-test/SIL/crashers_fixed/018-swift-valuedecl-getinterfacetype.sil
./validation-test/SIL/crashers_fixed/012-swift-dependentgenerictyperesolver-resolveselfassociatedtype.sil
./validation-test/SIL/crashers_fixed/030-swift-typechecker-checkdeclattributes.sil
./validation-test/SIL/crashers_fixed/041-swift-typebase-getdesugaredtype.sil
./validation-test/SIL/crashers_fixed/047-swift-silfunction-print.swift
./validation-test/SIL/crashers_fixed/005-swift-silfunction-verify.sil
./validation-test/SIL/crashers_fixed/042-swift-parser-parsetoplevel.sil
./validation-test/SIL/crashers_fixed/003-swift-parser-parsetypesimple.sil
./validation-test/SIL/crashers_fixed/043-swift-derivedconformance-deriverawrepresentable.sil
./validation-test/SIL/crashers_fixed/032-swift-iterativetypechecker-satisfy.sil
./validation-test/SIL/crashers_fixed/014-swift-sildeclref-sildeclref.sil
./validation-test/SIL/crashers_fixed/017-swift-decl-walk.sil
./validation-test/SIL/crashers_fixed/039-swift-iterativetypechecker-processresolvetypedecl.sil
./validation-test/SIL/crashers_fixed/046-swift-parser-parsetypesimpleorcomposition.sil
./validation-test/SIL/crashers_fixed/016-swift-typechecker-typecheckfunctionbodyuntil.sil
./validation-test/SIL/crashers_fixed/023-swift-parser-parseexpridentifier.sil
./validation-test/SIL/crashers_fixed/045-swift-parser-parseidentifier.sil
./validation-test/SIL/crashers_fixed/004-swift-expr-getsourcerange.sil
./validation-test/SIL/crashers_fixed/035-swift-typebase-getcanonicaltype.sil
./validation-test/SIL/crashers_fixed/025-swift-typechecker-resolvetype.sil
./validation-test/SIL/crashers_fixed/028-swift-genericsignature-getcanonicalsignature.sil
./validation-test/SIL/crashers_fixed/037-swift-sourcefile-lookupcache-lookupclassmembers.sil
./validation-test/SIL/crashers_fixed/008-swift-genericparamlist-getasgenericsignatureelements.sil
./validation-test/SIL/crashers_fixed/044-swift-parser-parsesilcoveragemap.sil
./validation-test/SIL/crashers_fixed/038-swift-archetypebuilder-enumeraterequirements.sil
./validation-test/SIL/crashers_fixed/026-swift-parser-parsesildefaultwitnesstable.sil
./validation-test/SIL/crashers_fixed/033-swift-constraints-constraintsystem-diagnosefailureforexpr.sil
./validation-test/SIL/verify_all_overlays.py
./validation-test/SIL/lit.local.cfg
./validation-test/lit.site.cfg.in
./validation-test/radar
./validation-test/radar/r17963339.swift
./validation-test/Reflection
./validation-test/Reflection/functions_objc.swift
./validation-test/Reflection/reflect_multiple_types.swift
./validation-test/Reflection/inherits_NSObject.swift
./validation-test/Reflection/reflect_Float.swift
./validation-test/Reflection/reflect_Double.swift
./validation-test/Reflection/reflect_Character.swift
./validation-test/Reflection/reflect_Dictionary.swift
./validation-test/Reflection/reflect_Enum_SingleCaseNoPayload.swift
./validation-test/Reflection/reflect_Enum_value.swift
./validation-test/Reflection/reflect_Enum_TwoCaseOneStructPayload.swift
./validation-test/Reflection/existentials.swift
./validation-test/Reflection/reflect_UInt64.swift
./validation-test/Reflection/functions.swift
./validation-test/Reflection/reflect_NSString.swift
./validation-test/Reflection/reflect_Bool.swift
./validation-test/Reflection/reflect_Int8.swift
./validation-test/Reflection/reflect_Int64.swift
./validation-test/Reflection/reflect_String.swift
./validation-test/Reflection/reflect_Enum_MultiPayload_value.swift
./validation-test/Reflection/reflect_empty_struct.swift
./validation-test/Reflection/reflect_existential.swift
./validation-test/Reflection/reflect_Enum_values.swift
./validation-test/Reflection/reflect_UInt8.swift
./validation-test/Reflection/reflect_UInt16.swift
./validation-test/Reflection/reflect_UInt32.swift
./validation-test/Reflection/reflect_Enum_SingleCasePointerPayload.swift
./validation-test/Reflection/reflect_NSNumber.swift
./validation-test/Reflection/reflect_nested.swift
./validation-test/Reflection/reflect_Enum_SingleCaseIntPayload.swift
./validation-test/Reflection/reflect_empty_class.swift
./validation-test/Reflection/reflect_NSSet.swift
./validation-test/Reflection/reflect_Enum_254CaseNoPayloads.swift
./validation-test/Reflection/reflect_empty_struct_compat.swift
./validation-test/Reflection/reflect_UInt.swift
./validation-test/Reflection/reflect_Int16.swift
./validation-test/Reflection/reflect_Int32.swift
./validation-test/Reflection/inherits_Swift.swift
./validation-test/Reflection/reflect_Set.swift
./validation-test/Reflection/reflect_Array.swift
./validation-test/Reflection/reflect_Enum_TwoCaseOnePointerPayload.swift
./validation-test/Reflection/reflect_Int.swift
./validation-test/Reflection/inherits_ObjCClasses.swift
./validation-test/Reflection/reflect_Enum_TwoCaseTwoPayloads.swift
./validation-test/Reflection/existentials_objc.swift
./validation-test/Reflection/reflect_Enum_NoCase.swift
./validation-test/Reflection/Inputs
./validation-test/Reflection/Inputs/ObjCClasses
./validation-test/Reflection/Inputs/ObjCClasses/ObjCClasses.m
./validation-test/Reflection/Inputs/ObjCClasses/module.map
./validation-test/Reflection/Inputs/ObjCClasses/ObjCClasses.h
./validation-test/Reflection/Inputs/EmptyStruct
./validation-test/Reflection/Inputs/EmptyStruct/module.map
./validation-test/Reflection/Inputs/EmptyStruct/EmptyStruct.h
./validation-test/Reflection/reflect_NSArray.swift
./validation-test/Reflection/reflect_Enum_TwoCaseNoPayload.swift
./tools
./tools/swift-syntax-parser-test
./tools/swift-syntax-parser-test/CMakeLists.txt
./tools/swift-syntax-parser-test/swift-syntax-parser-test.cpp
./tools/swift-ide-test
./tools/swift-ide-test/CMakeLists.txt
./tools/swift-ide-test/swift-ide-test.cpp
./tools/swift-ide-test/ModuleAPIDiff.cpp
./tools/swift-ide-test/XMLValidator.cpp
./tools/swift-ide-test/ModuleAPIDiff.h
./tools/swift-ide-test/XMLValidator.h
./tools/swift-demangle
./tools/swift-demangle/CMakeLists.txt
./tools/swift-demangle/swift-demangle.cpp
./tools/CMakeLists.txt
./tools/swift-inspect
./tools/swift-inspect/Tests
./tools/swift-inspect/Tests/LinuxMain.swift
./tools/swift-inspect/Tests/swiftInspectTests
./tools/swift-inspect/Tests/swiftInspectTests/XCTestManifests.swift
./tools/swift-inspect/Tests/swiftInspectTests/swiftInspectTests.swift
./tools/swift-inspect/README.md
./tools/swift-inspect/.gitignore
./tools/swift-inspect/Package.swift
./tools/swift-inspect/Sources
./tools/swift-inspect/Sources/swift-inspect
./tools/swift-inspect/Sources/swift-inspect/Metadata.swift
./tools/swift-inspect/Sources/swift-inspect/Inspector.swift
./tools/swift-inspect/Sources/swift-inspect/RemoteMirrorExtensions.swift
./tools/swift-inspect/Sources/swift-inspect/InterpolationExtensions.swift
./tools/swift-inspect/Sources/swift-inspect/symbolication.swift
./tools/swift-inspect/Sources/swift-inspect/stdio.swift
./tools/swift-inspect/Sources/swift-inspect/main.swift
./tools/swift-inspect/Sources/swift-inspect/Backtrace.swift
./tools/swift-inspect/Sources/SymbolicationShims
./tools/swift-inspect/Sources/SymbolicationShims/module.modulemap
./tools/swift-inspect/Sources/SymbolicationShims/SymbolicationShims.h
./tools/swift-inspect/build_script_helper.py
./tools/swift-llvm-opt
./tools/swift-llvm-opt/CMakeLists.txt
./tools/swift-llvm-opt/LLVMOpt.cpp
./tools/sil-func-extractor
./tools/sil-func-extractor/SILFunctionExtractor.cpp
./tools/sil-func-extractor/CMakeLists.txt
./tools/swift-ast-script
./tools/swift-ast-script/CMakeLists.txt
./tools/swift-ast-script/ASTScriptParser.cpp
./tools/swift-ast-script/ASTScriptConfiguration.h
./tools/swift-ast-script/swift-ast-script.cpp
./tools/swift-ast-script/ASTScriptConfiguration.cpp
./tools/swift-ast-script/ASTScriptEvaluator.cpp
./tools/swift-ast-script/ASTScript.h
./tools/swift-remoteast-test
./tools/swift-remoteast-test/messages.h
./tools/swift-remoteast-test/CMakeLists.txt
./tools/swift-remoteast-test/swift-remoteast-test.cpp
./tools/swift-reflection-dump
./tools/swift-reflection-dump/CMakeLists.txt
./tools/swift-reflection-dump/swift-reflection-dump.cpp
./tools/driver
./tools/driver/autolink_extract_main.cpp
./tools/driver/CMakeLists.txt
./tools/driver/swift_symbolgraph_extract_main.cpp
./tools/driver/modulewrap_main.cpp
./tools/driver/driver.cpp
./tools/driver/swift_indent_main.cpp
./tools/swift-syntax-test
./tools/swift-syntax-test/CMakeLists.txt
./tools/swift-syntax-test/swift-syntax-test.cpp
./tools/swift-dependency-tool
./tools/swift-dependency-tool/CMakeLists.txt
./tools/swift-dependency-tool/swift-dependency-tool.cpp
./tools/sil-opt
./tools/sil-opt/CMakeLists.txt
./tools/sil-opt/SILOpt.cpp
./tools/sil-passpipeline-dumper
./tools/sil-passpipeline-dumper/CMakeLists.txt
./tools/sil-passpipeline-dumper/SILPassPipelineDumper.cpp
./tools/libSwiftSyntaxParser
./tools/libSwiftSyntaxParser/libSwiftSyntaxParser.cpp
./tools/libSwiftSyntaxParser/CMakeLists.txt
./tools/libSwiftSyntaxParser/libSwiftSyntaxParser.exports
./tools/libSwiftSyntaxParser/c-include-check.c
./tools/lldb-moduleimport-test
./tools/lldb-moduleimport-test/CMakeLists.txt
./tools/lldb-moduleimport-test/lldb-moduleimport-test.cpp
./tools/sil-llvm-gen
./tools/sil-llvm-gen/CMakeLists.txt
./tools/sil-llvm-gen/SILLLVMGen.cpp
./tools/swift-stdlib-tool
./tools/swift-stdlib-tool/CMakeLists.txt
./tools/swift-stdlib-tool/swift-stdlib-tool.mm
./tools/swift-refactor
./tools/swift-refactor/swift-refactor.cpp
./tools/swift-refactor/CMakeLists.txt
./tools/swift-reflection-fuzzer
./tools/swift-reflection-fuzzer/CMakeLists.txt
./tools/swift-reflection-fuzzer/swift-reflection-fuzzer.cpp
./tools/swift-demangle-fuzzer
./tools/swift-demangle-fuzzer/swift-demangle-fuzzer.cpp
./tools/swift-demangle-fuzzer/CMakeLists.txt
./tools/sil-nm
./tools/sil-nm/CMakeLists.txt
./tools/sil-nm/SILNM.cpp
./tools/swift-api-digester
./tools/swift-api-digester/ModuleAnalyzerNodes.cpp
./tools/swift-api-digester/CMakeLists.txt
./tools/swift-api-digester/swift-api-digester.cpp
./tools/swift-api-digester/ModuleAnalyzerNodes.h
./tools/swift-api-digester/ModuleDiagsConsumer.h
./tools/swift-api-digester/ModuleDiagsConsumer.cpp
./tools/swift-demangle-yamldump
./tools/swift-demangle-yamldump/CMakeLists.txt
./tools/swift-demangle-yamldump/swift-demangle-yamldump.cpp
./tools/SourceKit
./tools/SourceKit/tools
./tools/SourceKit/tools/CMakeLists.txt
./tools/SourceKit/tools/complete-test
./tools/SourceKit/tools/complete-test/CMakeLists.txt
./tools/SourceKit/tools/complete-test/complete-test.cpp
./tools/SourceKit/tools/sourcekitd
./tools/SourceKit/tools/sourcekitd/CMakeLists.txt
./tools/SourceKit/tools/sourcekitd/bin
./tools/SourceKit/tools/sourcekitd/bin/InProc
./tools/SourceKit/tools/sourcekitd/bin/InProc/CMakeLists.txt
./tools/SourceKit/tools/sourcekitd/bin/InProc/sourcekitdInProc.cpp
./tools/SourceKit/tools/sourcekitd/bin/InProc/module.modulemap
./tools/SourceKit/tools/sourcekitd/bin/CMakeLists.txt
./tools/SourceKit/tools/sourcekitd/bin/sourcekitd.exports
./tools/SourceKit/tools/sourcekitd/bin/XPC
./tools/SourceKit/tools/sourcekitd/bin/XPC/CMakeLists.txt
./tools/SourceKit/tools/sourcekitd/bin/XPC/Service
./tools/SourceKit/tools/sourcekitd/bin/XPC/Service/CMakeLists.txt
./tools/SourceKit/tools/sourcekitd/bin/XPC/Service/XPCService.cpp
./tools/SourceKit/tools/sourcekitd/bin/XPC/Service/Info.plist
./tools/SourceKit/tools/sourcekitd/bin/XPC/Client
./tools/SourceKit/tools/sourcekitd/bin/XPC/Client/CMakeLists.txt
./tools/SourceKit/tools/sourcekitd/bin/XPC/Client/sourcekitd.cpp
./tools/SourceKit/tools/sourcekitd/bin/XPC/Client/module.modulemap
./tools/SourceKit/tools/sourcekitd/bin/XPC/Client/Info.plist
./tools/SourceKit/tools/sourcekitd/include
./tools/SourceKit/tools/sourcekitd/include/sourcekitd
./tools/SourceKit/tools/sourcekitd/include/sourcekitd/DocSupportAnnotationArray.h
./tools/SourceKit/tools/sourcekitd/include/sourcekitd/Internal.h
./tools/SourceKit/tools/sourcekitd/include/sourcekitd/DocStructureArray.h
./tools/SourceKit/tools/sourcekitd/include/sourcekitd/ExpressionTypeArray.h
./tools/SourceKit/tools/sourcekitd/include/sourcekitd/Logging.h
./tools/SourceKit/tools/sourcekitd/include/sourcekitd/TokenAnnotationsArray.h
./tools/SourceKit/tools/sourcekitd/include/sourcekitd/Internal-XPC.h
./tools/SourceKit/tools/sourcekitd/include/sourcekitd/CodeCompletionResultsArray.h
./tools/SourceKit/tools/sourcekitd/include/sourcekitd/CompactArray.h
./tools/SourceKit/tools/sourcekitd/include/sourcekitd/sourcekitd.h
./tools/SourceKit/tools/sourcekitd/include/sourcekitd/module.modulemap
./tools/SourceKit/tools/sourcekitd/include/sourcekitd/RawData.h
./tools/SourceKit/tools/sourcekitd/include/sourcekitd/RequestResponsePrinterBase.h
./tools/SourceKit/tools/sourcekitd/lib
./tools/SourceKit/tools/sourcekitd/lib/CMakeLists.txt
./tools/SourceKit/tools/sourcekitd/lib/API
./tools/SourceKit/tools/sourcekitd/lib/API/DocStructureArray.cpp
./tools/SourceKit/tools/sourcekitd/lib/API/CMakeLists.txt
./tools/SourceKit/tools/sourcekitd/lib/API/CompactArray.cpp
./tools/SourceKit/tools/sourcekitd/lib/API/CodeCompletionResultsArray.cpp
./tools/SourceKit/tools/sourcekitd/lib/API/sourcekitdAPI-XPC.cpp
./tools/SourceKit/tools/sourcekitd/lib/API/TokenAnnotationsArray.cpp
./tools/SourceKit/tools/sourcekitd/lib/API/DocSupportAnnotationArray.cpp
./tools/SourceKit/tools/sourcekitd/lib/API/RawData.cpp
./tools/SourceKit/tools/sourcekitd/lib/API/Requests.cpp
./tools/SourceKit/tools/sourcekitd/lib/API/DictionaryKeys.h
./tools/SourceKit/tools/sourcekitd/lib/API/sourcekitdAPI-Common.cpp
./tools/SourceKit/tools/sourcekitd/lib/API/ExpressionTypeArray.cpp
./tools/SourceKit/tools/sourcekitd/lib/API/sourcekitdAPI-InProc.cpp
./tools/SourceKit/tools/sourcekitd-test
./tools/SourceKit/tools/sourcekitd-test/CMakeLists.txt
./tools/SourceKit/tools/sourcekitd-test/TestOptions.cpp
./tools/SourceKit/tools/sourcekitd-test/Options.td
./tools/SourceKit/tools/sourcekitd-test/TestOptions.h
./tools/SourceKit/tools/sourcekitd-test/sourcekitd-test.cpp
./tools/SourceKit/tools/sourcekitd-repl
./tools/SourceKit/tools/sourcekitd-repl/CMakeLists.txt
./tools/SourceKit/tools/sourcekitd-repl/sourcekitd-repl.cpp
./tools/SourceKit/CMakeLists.txt
./tools/SourceKit/cmake
./tools/SourceKit/cmake/XPCServiceInfo.plist.in
./tools/SourceKit/cmake/FlatFrameworkInfo.plist.in
./tools/SourceKit/cmake/MacOSXFrameworkInfo.plist.in
./tools/SourceKit/cmake/modules
./tools/SourceKit/cmake/modules/AddSwiftSourceKit.cmake
./tools/SourceKit/include
./tools/SourceKit/include/CMakeLists.txt
./tools/SourceKit/include/SourceKit
./tools/SourceKit/include/SourceKit/CMakeLists.txt
./tools/SourceKit/include/SourceKit/Core
./tools/SourceKit/include/SourceKit/Core/ProtocolUIDs.def.gyb
./tools/SourceKit/include/SourceKit/Core/CMakeLists.txt
./tools/SourceKit/include/SourceKit/Core/NotificationCenter.h
./tools/SourceKit/include/SourceKit/Core/Context.h
./tools/SourceKit/include/SourceKit/Core/LLVM.h
./tools/SourceKit/include/SourceKit/Core/LangSupport.h
./tools/SourceKit/include/SourceKit/Config
./tools/SourceKit/include/SourceKit/Config/config.h.cmake
./tools/SourceKit/include/SourceKit/SwiftLang
./tools/SourceKit/include/SourceKit/SwiftLang/Factory.h
./tools/SourceKit/include/SourceKit/Support
./tools/SourceKit/include/SourceKit/Support/Concurrency.h
./tools/SourceKit/include/SourceKit/Support/UIdent.h
./tools/SourceKit/include/SourceKit/Support/Logging.h
./tools/SourceKit/include/SourceKit/Support/ThreadSafeRefCntPtr.h
./tools/SourceKit/include/SourceKit/Support/FileSystemProvider.h
./tools/SourceKit/include/SourceKit/Support/ImmutableTextBuffer.h
./tools/SourceKit/include/SourceKit/Support/Statistic.h
./tools/SourceKit/include/SourceKit/Support/FuzzyStringMatcher.h
./tools/SourceKit/include/SourceKit/Support/Tracing.h
./tools/SourceKit/docs
./tools/SourceKit/docs/SwiftSupport.txt
./tools/SourceKit/docs/Protocol.md
./tools/SourceKit/lib
./tools/SourceKit/lib/CMakeLists.txt
./tools/SourceKit/lib/Core
./tools/SourceKit/lib/Core/CMakeLists.txt
./tools/SourceKit/lib/Core/Context.cpp
./tools/SourceKit/lib/Core/LangSupport.cpp
./tools/SourceKit/lib/Core/NotificationCenter.cpp
./tools/SourceKit/lib/SwiftLang
./tools/SourceKit/lib/SwiftLang/SwiftEditorDiagConsumer.h
./tools/SourceKit/lib/SwiftLang/SwiftConformingMethodList.cpp
./tools/SourceKit/lib/SwiftLang/SwiftCompletion.cpp
./tools/SourceKit/lib/SwiftLang/CodeCompletionOrganizer.cpp
./tools/SourceKit/lib/SwiftLang/CMakeLists.txt
./tools/SourceKit/lib/SwiftLang/SwiftEditorInterfaceGen.cpp
./tools/SourceKit/lib/SwiftLang/SwiftInterfaceGenContext.h
./tools/SourceKit/lib/SwiftLang/SwiftDocSupport.cpp
./tools/SourceKit/lib/SwiftLang/SwiftLangSupport.cpp
./tools/SourceKit/lib/SwiftLang/SwiftSourceDocInfo.cpp
./tools/SourceKit/lib/SwiftLang/SwiftIndexing.cpp
./tools/SourceKit/lib/SwiftLang/SwiftTypeContextInfo.cpp
./tools/SourceKit/lib/SwiftLang/CodeCompletionOrganizer.h
./tools/SourceKit/lib/SwiftLang/SwiftEditor.cpp
./tools/SourceKit/lib/SwiftLang/SwiftLangSupport.h
./tools/SourceKit/lib/SwiftLang/CodeCompletion.h
./tools/SourceKit/lib/SwiftLang/SwiftStatistics.def
./tools/SourceKit/lib/SwiftLang/SwiftInvocation.h
./tools/SourceKit/lib/SwiftLang/SwiftASTManager.h
./tools/SourceKit/lib/SwiftLang/SwiftASTManager.cpp
./tools/SourceKit/lib/Support
./tools/SourceKit/lib/Support/UIDRegistry.cpp
./tools/SourceKit/lib/Support/CMakeLists.txt
./tools/SourceKit/lib/Support/ImmutableTextBuffer.cpp
./tools/SourceKit/lib/Support/Logging.cpp
./tools/SourceKit/lib/Support/Tracing.cpp
./tools/SourceKit/lib/Support/Concurrency-libdispatch.cpp
./tools/SourceKit/lib/Support/FuzzyStringMatcher.cpp
./tools/SourceKit/lib/Support/ThreadSafeRefCntPtr.cpp
./tools/SourceKit/README.txt
./tools/SourceKit/bindings
./tools/SourceKit/bindings/python
./tools/SourceKit/bindings/python/sourcekitd
./tools/SourceKit/bindings/python/sourcekitd/capi.py
./tools/SourceKit/bindings/python/sourcekitd/request.py
./tools/SourceKit/bindings/python/sourcekitd/__init__.py
./CMakeLists.txt
./test
./test/stmt
./test/stmt/yield.swift
./test/stmt/rdar40400251.swift
./test/stmt/statements.swift
./test/stmt/c_style_for.swift
./test/stmt/errors_objc.swift
./test/stmt/if_while_var.swift
./test/stmt/switch_stmt2.swift
./test/stmt/errors_nonobjc.swift
./test/stmt/switch_stmt_editor1.swift
./test/stmt/errors.swift
./test/stmt/nonexhaustive_switch_stmt_editor.swift
./test/stmt/switch_stmt1.swift
./test/stmt/if_unexpected_else.swift
./test/stmt/foreach.swift
./test/stmt/Inputs
./test/stmt/Inputs/Foundation-with-NSError.swift
./test/stmt/switch_stmt_editor2.swift
./test/Compatibility
./test/Compatibility/special_case_name.swift
./test/Compatibility/attr_inlinable_dynamic.swift
./test/Compatibility/attr_override_lazy.swift
./test/Compatibility/attr_inlinable_typealias_swift42.swift
./test/Compatibility/self.swift
./test/Compatibility/ownership_protocol.swift
./test/Compatibility/attr_usableFromInline_protocol.swift
./test/Compatibility/anyobject_class.swift
./test/Compatibility/MixAndMatch
./test/Compatibility/MixAndMatch/witness_change.swift
./test/Compatibility/MixAndMatch/Inputs
./test/Compatibility/MixAndMatch/Inputs/witness_change_swift4_leaf.swift
./test/Compatibility/MixAndMatch/Inputs/SomeObjCModule.apinotes
./test/Compatibility/MixAndMatch/Inputs/witness_change_swift5.swift
./test/Compatibility/MixAndMatch/Inputs/SomeObjCModuleX.swift
./test/Compatibility/MixAndMatch/Inputs/SomeObjCModule.h
./test/Compatibility/MixAndMatch/Inputs/module.modulemap
./test/Compatibility/default_init.swift
./test/Compatibility/attr_usableFromInline_swift4.swift
./test/Compatibility/accessibility.swift
./test/Compatibility/protocol_composition.swift
./test/Compatibility/operators.swift
./test/Compatibility/stdlib_generic_typealiases.swift
./test/Compatibility/dynamic_self_swift4.swift
./test/Compatibility/attr_inlinable_typealias_swift4.swift
./test/Compatibility/attr_inlinable_old_spelling_42.swift
./test/Compatibility/implicit_tupling_untupling_codegen.swift
./test/Compatibility/shared_owned_identifiers.swift
./test/Compatibility/tuple_arguments_4.swift
./test/Compatibility/special_func_name.swift
./test/Compatibility/exhaustive_switch.swift
./test/Compatibility/attr_usableFromInline_swift42.swift
./test/Compatibility/attr_override.swift
./test/Compatibility/optional_visibility.swift
./test/Compatibility/attr_inlinable_old_spelling_4.swift
./test/Compatibility/attr_autoclosure.swift
./test/Compatibility/local_types.swift
./test/Compatibility/attr_inlinable_swift42.swift
./test/Compatibility/accessibility_where.swift
./test/Compatibility/lvalue_typeof.swift
./test/Compatibility/throws_identifier.swift
./test/swift_test.py
./test/benchmark
./test/benchmark/Benchmark_O.test.md
./test/benchmark/benchmark-scripts.test-sh
./test/benchmark/Benchmark_Driver.test-sh
./test/benchmark/lit.local.cfg
./test/Interpreter
./test/Interpreter/objc_class_resilience_stubs.swift
./test/Interpreter/dynamicReplacement_property_observer.swift
./test/Interpreter/tuple_casts.swift
./test/Interpreter/wildcard_dispatch_on_catch.swift
./test/Interpreter/enum_runtime_alignment.swift
./test/Interpreter/use_public_var_private_setter.swift
./test/Interpreter/patternmatch_on_enum_protocol_leak.swift
./test/Interpreter/weak_objc.swift
./test/Interpreter/submodules_smoke_test.swift
./test/Interpreter/arrays.swift
./test/Interpreter/protocol_extensions.swift
./test/Interpreter/unicode_scalar_literal.swift
./test/Interpreter/protocol_initializers_class.swift
./test/Interpreter/generic_subscript_static.swift
./test/Interpreter/extended_grapheme_cluster_literal.swift
./test/Interpreter/withoutActuallyEscapingBlocks.swift
./test/Interpreter/objc_extensions.swift
./test/Interpreter/return_from_main.swift
./test/Interpreter/properties.swift
./test/Interpreter/polymorphic_builtins.swift
./test/Interpreter/dictOfAny.swift
./test/Interpreter/enum_Error.swift
./test/Interpreter/struct_equatable_hashable_correctness.swift
./test/Interpreter/interpret_load_framework.swift
./test/Interpreter/objc_class_properties_runtime.swift
./test/Interpreter/shebang-env.swift
./test/Interpreter/failable_initializers.swift
./test/Interpreter/dependent_reabstraction.swift
./test/Interpreter/convenience_init_peer_delegation.swift
./test/Interpreter/unions-and-bitfields.swift
./test/Interpreter/generic_implicit_closure.swift
./test/Interpreter/unresolvable_dynamic_metadata_cycles.swift
./test/Interpreter/generic_struct.swift
./test/Interpreter/struct_extra_inhabitants.swift
./test/Interpreter/where_clause_contextually_generic_decl.swift
./test/Interpreter/errors_imported.swift
./test/Interpreter/NewtypeLeak.swift
./test/Interpreter/imported_objc_generics_extension.swift
./test/Interpreter/unowned_overflow.swift
./test/Interpreter/constructor.swift
./test/Interpreter/initializers.swift
./test/Interpreter/capture_inout.swift
./test/Interpreter/lifetime_nonmutating_address_only.swift
./test/Interpreter/global_resilience.swift
./test/Interpreter/conditional_conformances.swift
./test/Interpreter/ptrauth-kvo.swift
./test/Interpreter/conditional_conformances_runtime.swift
./test/Interpreter/capture_unowned.swift
./test/Interpreter/strong_retain_unowned_mispairing.swift
./test/Interpreter/bridged_casts_folding.swift
./test/Interpreter/conversions.swift
./test/Interpreter/external_key_path_ref.swift
./test/Interpreter/protocol_lookup.swift
./test/Interpreter/varargs.swift
./test/Interpreter/conditional_conformances_smoke.swift
./test/Interpreter/c_unions.swift
./test/Interpreter/objc_throw_in_noescape_block.swift
./test/Interpreter/dynamic_replacement_protocol_self.swift
./test/Interpreter/typeof.swift
./test/Interpreter/objc_metatypes.swift
./test/Interpreter/generic_ref_counts.swift
./test/Interpreter/opt_unowned.swift
./test/Interpreter/rdar15674812.swift
./test/Interpreter/class_resilience.swift
./test/Interpreter/functions.swift
./test/Interpreter/selector_arguments.swift
./test/Interpreter/class_in_constrained_extension.swift
./test/Interpreter/fractal.swift
./test/Interpreter/statements.swift
./test/Interpreter/dynamic_replacement_chaining.swift
./test/Interpreter/layout_reabstraction.swift
./test/Interpreter/opt_unowned_objc.swift
./test/Interpreter/objc_bool.swift
./test/Interpreter/FunctionConversion.swift
./test/Interpreter/apply_partial_apply_consuming_elim.swift
./test/Interpreter/error_self_conformance.swift
./test/Interpreter/dynamic_cast_set_conditional_type_metadata.swift
./test/Interpreter/classes.swift
./test/Interpreter/throwing_initializers.swift
./test/Interpreter/hello_toplevel.swift
./test/Interpreter/indirect_enum.swift
./test/Interpreter/protocol_initializers.swift
./test/Interpreter/process_arguments.swift
./test/Interpreter/c_bitfields.swift
./test/Interpreter/switch_resilience.swift
./test/Interpreter/convenience_init_swift5.swift
./test/Interpreter/super_constructor.swift
./test/Interpreter/simd.swift
./test/Interpreter/import_as_member.swift
./test/Interpreter/objc_extensions_jit.swift
./test/Interpreter/metatype.swift
./test/Interpreter/binary_operator_perf.swift
./test/Interpreter/slices.swift
./test/Interpreter/hello_func.swift
./test/Interpreter/objc_class_resilience.swift
./test/Interpreter/string_literal.swift
./test/Interpreter/generic_class_empty_field.swift
./test/Interpreter/enum_resilience.swift
./test/Interpreter/subclass_existentials.swift
./test/Interpreter/dynamic_cast_set_unconditional_type_metadata.swift
./test/Interpreter/dynamic_self.swift
./test/Interpreter/static_objc_var.swift
./test/Interpreter/formal_access.swift
./test/Interpreter/enum_equatable_hashable_correctness.swift
./test/Interpreter/dynamic_cast_optionals_to_nsobject.swift
./test/Interpreter/collection_casts.swift
./test/Interpreter/field_offset_generic.swift
./test/Interpreter/destructors.swift
./test/Interpreter/bool_as_generic.swift
./test/Interpreter/archetype_casts.swift
./test/Interpreter/defer.swift
./test/Interpreter/function_metatypes.swift
./test/Interpreter/generic_objc_subclass.swift
./test/Interpreter/lazy_properties.swift
./test/Interpreter/RosettaCode.swift
./test/Interpreter/algorithms.swift
./test/Interpreter/generic_tuple.swift
./test/Interpreter/casts.swift
./test/Interpreter/subscripting.swift
./test/Interpreter/protocol_resilience.swift
./test/Interpreter/if_expr.swift
./test/Interpreter/structs.swift
./test/Interpreter/switch.swift
./test/Interpreter/availability_weak_linking.swift
./test/Interpreter/objc_class_properties.swift
./test/Interpreter/bitvector.swift
./test/Interpreter/complex.swift
./test/Interpreter/protocols.swift
./test/Interpreter/currying_generics.swift
./test/Interpreter/SDK
./test/Interpreter/SDK/NSDecimal.swift
./test/Interpreter/SDK/objc_block_consumed.swift
./test/Interpreter/SDK/UIActionSheetHack.swift
./test/Interpreter/SDK/objc_swift3_deprecated_objc_inference.swift
./test/Interpreter/SDK/check_class_for_archiving.swift
./test/Interpreter/SDK/objc_block_generic.swift
./test/Interpreter/SDK/block_globals.swift
./test/Interpreter/SDK/submodules_smoke_test.swift
./test/Interpreter/SDK/UIApplicationMain.swift
./test/Interpreter/SDK/objc_mangling.swift
./test/Interpreter/SDK/objc_dealloc.swift
./test/Interpreter/SDK/autorelease.swift
./test/Interpreter/SDK/c_pointers.swift
./test/Interpreter/SDK/weak_objc_interop.swift
./test/Interpreter/SDK/cf_type_bridging.swift
./test/Interpreter/SDK/objc_extensions.swift
./test/Interpreter/SDK/objc_inner_pointer.swift
./test/Interpreter/SDK/objc_currying.swift
./test/Interpreter/SDK/GLKit.swift
./test/Interpreter/SDK/misc_osx.swift
./test/Interpreter/SDK/header_static.swift
./test/Interpreter/SDK/objc_dynamic_lookup.swift
./test/Interpreter/SDK/mapkit_header_static.swift
./test/Interpreter/SDK/convenience_init_peer_delegation.swift
./test/Interpreter/SDK/objc_keypath.swift
./test/Interpreter/SDK/class_getImageName.swift
./test/Interpreter/SDK/Foundation_bridge.swift
./test/Interpreter/SDK/interpret_with_options.swift
./test/Interpreter/SDK/objc_factory_method.swift
./test/Interpreter/SDK/archive_attributes_stable_abi.swift
./test/Interpreter/SDK/class_getImageName-static.swift
./test/Interpreter/SDK/Foundation_test.swift
./test/Interpreter/SDK/mixed_mode_class_with_missing_properties.swift
./test/Interpreter/SDK/NSApplicationMain.swift
./test/Interpreter/SDK/Foundation_NSString.swift
./test/Interpreter/SDK/Cocoa_transitive.swift
./test/Interpreter/SDK/OS_objects.swift
./test/Interpreter/SDK/check_class_for_archiving_log.swift
./test/Interpreter/SDK/objc_unowned.swift
./test/Interpreter/SDK/Cocoa_enums.swift
./test/Interpreter/SDK/protocol_lookup_foreign.swift
./test/Interpreter/SDK/archiving_generic_swift_class.swift
./test/Interpreter/SDK/Foundation_CFString.swift
./test/Interpreter/SDK/cf.swift
./test/Interpreter/SDK/objc_witness_to_swift_protocol.swift
./test/Interpreter/SDK/cf_extensions.swift
./test/Interpreter/SDK/GLKit_jit.swift
./test/Interpreter/SDK/archive_attributes.swift
./test/Interpreter/SDK/objc_dynamic_subclass_protocol_lookup.swift
./test/Interpreter/SDK/block_calls.swift
./test/Interpreter/SDK/CoreFoundation_casting.swift
./test/Interpreter/SDK/objc_switch.swift
./test/Interpreter/SDK/objc_fast_enumeration.swift
./test/Interpreter/SDK/cf_without_foundation.swift
./test/Interpreter/SDK/objc_bridge_cast.swift
./test/Interpreter/SDK/objc_protocol_lookup_jit.swift
./test/Interpreter/SDK/Foundation_NSLog.swift
./test/Interpreter/SDK/objc_array_of_classes.swift
./test/Interpreter/SDK/SwiftNativeNSXXXCoding.swift
./test/Interpreter/SDK/objc_bridge_cast_newtype.swift
./test/Interpreter/SDK/dictionary_pattern_matching.swift
./test/Interpreter/SDK/Foundation_NSLocalizedString.swift
./test/Interpreter/SDK/dynamic_subclass.swift
./test/Interpreter/SDK/Reflection_KVO.swift
./test/Interpreter/SDK/Foundation_NSExpression.swift
./test/Interpreter/SDK/Foundation_NSPredicate.swift
./test/Interpreter/SDK/objc_subclass.swift
./test/Interpreter/SDK/libc.swift
./test/Interpreter/SDK/AnyObject_native_interop.swift
./test/Interpreter/SDK/autolinking.swift
./test/Interpreter/SDK/objc_protocol_lookup.swift
./test/Interpreter/SDK/class_as_object.swift
./test/Interpreter/SDK/multi-file-imported-enum.swift
./test/Interpreter/SDK/objc_ns_enum.swift
./test/Interpreter/SDK/Quartz_without_Foundation.swift
./test/Interpreter/SDK/archive_compatibility.swift
./test/Interpreter/SDK/Foundation_printing.swift
./test/Interpreter/SDK/Foundation_NSRect.swift
./test/Interpreter/SDK/equatable_hashable.swift
./test/Interpreter/SDK/objc_getClass.swift
./test/Interpreter/SDK/glob.swift
./test/Interpreter/SDK/Accelerate.swift
./test/Interpreter/SDK/objc_old_swift.swift
./test/Interpreter/SDK/errors.swift
./test/Interpreter/SDK/GLKit_parse.swift
./test/Interpreter/SDK/objc_nsstring_bridge.swift
./test/Interpreter/SDK/objc_nil.swift
./test/Interpreter/SDK/object_literals.swift
./test/Interpreter/SDK/FoundationDiagnostics.swift
./test/Interpreter/SDK/c_function_pointer_compile.swift
./test/Interpreter/SDK/objc_swift_getObjectType.swift
./test/Interpreter/SDK/objc_failable_initializers.swift
./test/Interpreter/SDK/objc_cast.swift
./test/Interpreter/SDK/Inputs
./test/Interpreter/SDK/Inputs/objc_bridge_cast_newtype.h
./test/Interpreter/SDK/Inputs/multi-file-imported-enum
./test/Interpreter/SDK/Inputs/multi-file-imported-enum/main.swift
./test/Interpreter/SDK/Inputs/test.arc
./test/Interpreter/SDK/Inputs/BlockGlobals
./test/Interpreter/SDK/Inputs/BlockGlobals/BlockGlobals.m
./test/Interpreter/SDK/Inputs/BlockGlobals/BlockGlobals.h
./test/Interpreter/SDK/Inputs/object_literals-Resources
./test/Interpreter/SDK/Inputs/object_literals-Resources/testData.plist
./test/Interpreter/SDK/Inputs/convenience_init_peer_delegation.h
./test/Interpreter/SDK/Inputs/objc_implicit_inner_pointer
./test/Interpreter/SDK/Inputs/objc_implicit_inner_pointer/objc_implicit_inner_pointer.m
./test/Interpreter/SDK/Inputs/objc_implicit_inner_pointer/objc_implicit_inner_pointer.h
./test/Interpreter/SDK/Inputs/Foundation_bridge.h
./test/Interpreter/SDK/Inputs/errors.h
./test/Interpreter/SDK/Inputs/ObjCWeak
./test/Interpreter/SDK/Inputs/ObjCWeak/ObjCWeak.m
./test/Interpreter/SDK/Inputs/ObjCWeak/module.map
./test/Interpreter/SDK/Inputs/ObjCWeak/ObjCWeak.h
./test/Interpreter/SDK/Inputs/check_class_for_archiving.h
./test/Interpreter/SDK/Inputs/mixed_mode
./test/Interpreter/SDK/Inputs/mixed_mode/UsingObjCStuff.swift
./test/Interpreter/SDK/Inputs/mixed_mode/ObjCStuff.h
./test/Interpreter/SDK/Inputs/mixed_mode/module.modulemap
./test/Interpreter/SDK/Inputs/mixed_mode/ObjCStuff.apinotes
./test/Interpreter/SDK/Inputs/class_getImageName-static-helper.h
./test/Interpreter/SDK/Inputs/class_getImageName-helper.swift
./test/Interpreter/SDK/Inputs/custom-modules
./test/Interpreter/SDK/Inputs/custom-modules/DispatchObjects.h
./test/Interpreter/SDK/Inputs/custom-modules/module.map
./test/Interpreter/SDK/Inputs/SimpleNSObjectSubclass.swift
./test/Interpreter/SDK/Inputs/OldABI
./test/Interpreter/SDK/Inputs/OldABI/module.map
./test/Interpreter/SDK/Inputs/OldABI/OldABI.h
./test/Interpreter/SDK/Inputs/OldABI/OldABI.mm
./test/Interpreter/SDK/Inputs/convenience_init_peer_delegation.m
./test/Interpreter/SDK/Inputs/libTestLoad.dylib
./test/Interpreter/SDK/Inputs/objc_block_consumed.h
./test/Interpreter/SDK/objc_implicit_inner_pointer.swift
./test/Interpreter/SDK/CoreImage_without_Foundation.swift
./test/Interpreter/SDK/objc_bridge.swift
./test/Interpreter/SDK/KVO.swift
./test/Interpreter/objc_failable_composed_with_throwing_initializers.swift
./test/Interpreter/shebang-direct.swift
./test/Interpreter/testable_key_path.swift
./test/Interpreter/property_wrappers.swift
./test/Interpreter/dynamic_replacement_opaque_result2.swift
./test/Interpreter/array_of_optional.swift
./test/Interpreter/interpolation.swift
./test/Interpreter/objc_protocols.swift
./test/Interpreter/objc_throwing_initializers.swift
./test/Interpreter/simple.swift
./test/Interpreter/tuples.swift
./test/Interpreter/protocol_lookup_jit.swift
./test/Interpreter/ptrauth-function-pointers.swift
./test/Interpreter/currying_protocols.swift
./test/Interpreter/ForeignMetadata.swift
./test/Interpreter/keypath.swift
./test/Interpreter/switch_objc.swift
./test/Interpreter/availability_host_os.swift
./test/Interpreter/resilient_metadata_cycles.swift
./test/Interpreter/writeback.swift
./test/Interpreter/capture_top_level.swift
./test/Interpreter/break_continue.swift
./test/Interpreter/closures.swift
./test/Interpreter/switch_where_clause.swift
./test/Interpreter/generic_casts.swift
./test/Interpreter/errors.swift
./test/Interpreter/dynamic_replacement_multifile
./test/Interpreter/dynamic_replacement_multifile/main.swift
./test/Interpreter/dynamic_replacement_multifile/Inputs
./test/Interpreter/dynamic_replacement_multifile/Inputs/dynamic_replacement_multi_file_A.swift
./test/Interpreter/dynamic_replacement_multifile/Inputs/dynamic_replacement_multi_file_B.swift
./test/Interpreter/generics.swift
./test/Interpreter/opaque_return_type_protocol_ext.swift
./test/Interpreter/generic_casts_objc.swift
./test/Interpreter/synthesized_extension_conformances.swift
./test/Interpreter/testability.swift
./test/Interpreter/mandatory_inlining.swift
./test/Interpreter/generic_subscript.swift
./test/Interpreter/dynamic_replacement.swift
./test/Interpreter/enforce_exclusive_access.swift
./test/Interpreter/multi_payload_shifting.swift
./test/Interpreter/existential_transform.swift
./test/Interpreter/unused-type.swift
./test/Interpreter/object.swift
./test/Interpreter/metadata_cycles.swift
./test/Interpreter/subclass_existentials_objc.swift
./test/Interpreter/builtin_bridge_object.swift
./test/Interpreter/SR-10600.swift
./test/Interpreter/ClosureLeak.swift
./test/Interpreter/optional.swift
./test/Interpreter/multi_payload_extra_inhabitant.swift
./test/Interpreter/generic_class.swift
./test/Interpreter/withoutActuallyEscaping.swift
./test/Interpreter/generalized_accessors.swift
./test/Interpreter/builtin.swift
./test/Interpreter/enum-nonexhaustivity.swift
./test/Interpreter/objc_runtime_visible.swift
./test/Interpreter/conditional_conformances_modules.swift
./test/Interpreter/mandelbrot.swift
./test/Interpreter/enum.swift
./test/Interpreter/imported_objc_generics.swift
./test/Interpreter/dynamic_cast_dict_unconditional_type_metadata.swift
./test/Interpreter/enum_equatable_hashable_correctness_future.swift
./test/Interpreter/optional_lvalues.swift
./test/Interpreter/dynamic_replacement_without_previous_calls.swift
./test/Interpreter/enum_bridged.swift
./test/Interpreter/dynamic_cast_dict_conditional_type_metadata.swift
./test/Interpreter/objc_failable_initializers.swift
./test/Interpreter/checked_cast_test.swift
./test/Interpreter/nested_generics.swift
./test/Interpreter/Inputs
./test/Interpreter/Inputs/dynamic_replacement_module.swift
./test/Interpreter/Inputs/VerySmallObjCFramework.framework
./test/Interpreter/Inputs/VerySmallObjCFramework.framework/Headers
./test/Interpreter/Inputs/VerySmallObjCFramework.framework/Headers/VerySmallObjCFramework.h
./test/Interpreter/Inputs/VerySmallObjCFramework.framework/Modules
./test/Interpreter/Inputs/VerySmallObjCFramework.framework/Modules/module.modulemap
./test/Interpreter/Inputs/dynamic_replacement_property_observer_orig.swift
./test/Interpreter/Inputs/availability_host_os.h
./test/Interpreter/Inputs/dynamic_replacement_without_previous_calls1.swift
./test/Interpreter/Inputs/ForeignTypeMetadata1.swift
./test/Interpreter/Inputs/usr
./test/Interpreter/Inputs/usr/include
./test/Interpreter/Inputs/usr/include/module.map
./test/Interpreter/Inputs/usr/include/newtype.h
./test/Interpreter/Inputs/dynamic_replacement_chaining_A.swift
./test/Interpreter/Inputs/FakeUnavailableSwiftDylib.swift
./test/Interpreter/Inputs/resilient_generic_struct_v1.swift
./test/Interpreter/Inputs/ObjCClasses
./test/Interpreter/Inputs/ObjCClasses/ObjCClasses.m
./test/Interpreter/Inputs/ObjCClasses/module.map
./test/Interpreter/Inputs/ObjCClasses/ObjCClasses.h
./test/Interpreter/Inputs/FakeUnavailableObjCFramework.framework
./test/Interpreter/Inputs/FakeUnavailableObjCFramework.framework/Headers
./test/Interpreter/Inputs/FakeUnavailableObjCFramework.framework/Headers/FakeUnavailableObjCFramework.h
./test/Interpreter/Inputs/FakeUnavailableObjCFramework.framework/Modules
./test/Interpreter/Inputs/FakeUnavailableObjCFramework.framework/Modules/module.modulemap
./test/Interpreter/Inputs/ObjCException.h
./test/Interpreter/Inputs/objc_runtime_visible.h
./test/Interpreter/Inputs/dynamic_replacement_chaining_B.swift
./test/Interpreter/Inputs/ForeignTypeMetadata2.swift
./test/Interpreter/Inputs/dynamic_replacement_without_previous_calls2.swift
./test/Interpreter/Inputs/implementation.swift
./test/Interpreter/Inputs/dynamic_replacement_protocol_self_orig.swift
./test/Interpreter/Inputs/resilient_generic_struct_v2.swift
./test/Interpreter/Inputs/VerySmallObjCFramework.m
./test/Interpreter/Inputs/public_var_private_setter.swift
./test/Interpreter/Inputs/newtype.m
./test/Interpreter/Inputs/legacy_type_info
./test/Interpreter/Inputs/legacy_type_info/jit_metadata_strategy.yaml
./test/Interpreter/Inputs/unions-and-bitfields.h
./test/Interpreter/Inputs/ImportAsMember
./test/Interpreter/Inputs/ImportAsMember/IAMVec.c
./test/Interpreter/Inputs/ImportAsMember/module.map
./test/Interpreter/Inputs/ImportAsMember/IAMVec.h
./test/Interpreter/Inputs/dynamic_replacement_dlclose.swift
./test/Interpreter/Inputs/ExplicitSubmodulesOnly.framework
./test/Interpreter/Inputs/ExplicitSubmodulesOnly.framework/Headers
./test/Interpreter/Inputs/ExplicitSubmodulesOnly.framework/Headers/A.h
./test/Interpreter/Inputs/ExplicitSubmodulesOnly.framework/Headers/B.h
./test/Interpreter/Inputs/ExplicitSubmodulesOnly.framework/Modules
./test/Interpreter/Inputs/ExplicitSubmodulesOnly.framework/Modules/module.modulemap
./test/Interpreter/Inputs/testability_helper.swift
./test/Interpreter/Inputs/vtables_multifile_2.swift
./test/Interpreter/Inputs/resilient_objc_class.swift
./test/Interpreter/Inputs/struct_extra_inhabitants_ExtraInhabitantResilientTypes.swift
./test/Interpreter/Inputs/dynamic_replacement_dlclose2.swift
./test/Interpreter/Inputs/objc_runtime_visible.m
./test/Interpreter/Inputs/ObjCException.m
./test/Interpreter/Inputs/enum-nonexhaustivity.h
./test/Interpreter/Inputs/testable_key_path_2.swift
./test/Interpreter/Inputs/FakeUnavailableObjCFramework.m
./test/Interpreter/Inputs/dynamic_replacement_property_observer_repl.swift
./test/Interpreter/struct_resilience.swift
./test/Interpreter/vtables_multifile.swift
./test/Interpreter/jit_metadata_strategy.swift
./test/Interpreter/weak.swift
./test/Interpreter/dynamic_lookup.swift
./test/Interpreter/objc_types_as_members.swift
./test/Generics
./test/Generics/invalid.swift
./test/Generics/associated_type_where_clause_hints.swift
./test/Generics/function_decls.swift
./test/Generics/conditional_conformances_fixit.swift
./test/Generics/materializable_restrictions.swift
./test/Generics/constrained_optional_params.swift
./test/Generics/conditional_conformances_literals.swift
./test/Generics/where_clause_contextually_generic_decls.swift
./test/Generics/conditional_conformances_operators.swift
./test/Generics/associated_type_where_clause.swift
./test/Generics/associated_types.swift
./test/Generics/rdar48049725.swift
./test/Generics/conditional_conformances.swift
./test/Generics/protocol_where_clause.swift
./test/Generics/associated_types_inherit.swift
./test/Generics/deduction.swift
./test/Generics/non_generic_derived_class.swift
./test/Generics/inheritance.swift
./test/Generics/superclass_constraint.swift
./test/Generics/class_constraint.swift
./test/Generics/sr7275.swift
./test/Generics/canonicalization.swift
./test/Generics/conditional_conformances_objc.swift
./test/Generics/sr8945.swift
./test/Generics/associated_types_multi_file.swift
./test/Generics/superclass_constraint_nested_type.swift
./test/Generics/sr5726.swift
./test/Generics/associated_type_typo.swift
./test/Generics/algorithms.swift
./test/Generics/existential_restrictions.swift
./test/Generics/associated_self_constraints.swift
./test/Generics/same_type_constraints.swift
./test/Generics/generic-nested-in-extension-on-objc-class.swift
./test/Generics/slice_test.swift
./test/Generics/same_type_constraints_objc.swift
./test/Generics/function_defs.swift
./test/Generics/typealias-in-extension-of-external-protocol.swift
./test/Generics/conditional_conformances_fixit.swift.result
./test/Generics/generic_types.swift
./test/Generics/protocol_type_aliases.swift
./test/Generics/protocol_requirement_signatures.swift
./test/Generics/conformance_access_path.swift
./test/Generics/requirement_inference.swift
./test/Generics/unbound.swift
./test/Generics/associated_type_anchor_rdar47605019.swift
./test/Generics/conditional_conformances_execute_smoke.swift
./test/Generics/validate_stdlib_generic_signatures.swift
./test/Generics/Inputs
./test/Generics/Inputs/conditional_conformances_objc.h
./test/Generics/Inputs/external-protocol.swift
./test/Generics/Inputs/rdar48049725_other.swift
./test/Generics/Inputs/generic-nested-in-extension-on-objc-class.swift
./test/Generics/Inputs/sr8945-other.swift
./test/Generics/Inputs/associated_types_multi_file_helper.swift
./test/Generics/nested_type_reference.swift
./test/IDE
./test/IDE/complete_declname.swift
./test/IDE/print_usrs_opaque_types.swift
./test/IDE/range_info_implicit.swift
./test/IDE/complete_crossmodule.swift
./test/IDE/print_usrs.swift
./test/IDE/complete_single_expression_return.swift
./test/IDE/print_omit_needless_words_appkit.swift
./test/IDE/complete_cross_import_multiple.swift
./test/IDE/complete_stmt_controlling_expr.swift
./test/IDE/complete_at_top_level.swift
./test/IDE/coloring_52982457.swift
./test/IDE/complete_literal.swift
./test/IDE/complete_func_no_closing_brace_at_eof_2.swift
./test/IDE/complete_weak.swift
./test/IDE/complete_cross_import_indirect.swift
./test/IDE/complete_func_no_closing_brace.swift
./test/IDE/complete_pound_keypath.swift
./test/IDE/complete_stdlib_builtin.swift
./test/IDE/complete_pattern.swift
./test/IDE/complete_from_constraint_extensions.swift
./test/IDE/complete_crashes.swift
./test/IDE/complete_repeat.swift
./test/IDE/print_ast_tc_function_bodies.swift
./test/IDE/complete_init.swift
./test/IDE/complete_associated_types.swift
./test/IDE/newtype_objc.swift
./test/IDE/complete_after_super.swift
./test/IDE/print_ast_typechecked.swift
./test/IDE/print_ast_overlay.swift
./test/IDE/complete_function_builder.swift
./test/IDE/complete_opaque_result.swift
./test/IDE/complete_from_foundation_overlay.swift
./test/IDE/print_clang_header_swift_name.swift
./test/IDE/coloring_class_restriction.swift
./test/IDE/expr_type.swift
./test/IDE/complete_escaped_keyword.swift
./test/IDE/complete_dynamic_lookup.swift
./test/IDE/merge_local_types.swift
./test/IDE/complete_keywords.swift
./test/IDE/complete_exception.swift
./test/IDE/print_clang_header.swift
./test/IDE/range_info_expr.swift
./test/IDE/complete_import_multifile1.swift
./test/IDE/complete_with_header_import.swift
./test/IDE/print_clang_decls.swift
./test/IDE/complete_stdlib_optional.swift
./test/IDE/print_opaque_result_type.swift
./test/IDE/print_clang_category_ordering.swift
./test/IDE/complete_with_closure_param.swift
./test/IDE/complete_where_clause.swift
./test/IDE/print_module_comments.swift
./test/IDE/coloring_unclosed_hash_if.swift
./test/IDE/print_clang_decls_AppKit.swift
./test/IDE/complete_at_eof_in_call_no_newline_1.swift
./test/IDE/complete_multiple_files.swift
./test/IDE/complete_subscript.swift
./test/IDE/complete_after_sself.swift
./test/IDE/range_info_comments.swift
./test/IDE/import_as_member_objc.swift
./test/IDE/complete_cross_import.swift
./test/IDE/comment_merge.swift
./test/IDE/unterminated_multiline.swift
./test/IDE/complete_type_any.swift
./test/IDE/print_source_file_interface_1.swift.result
./test/IDE/range_info_throwing.swift
./test/IDE/complete_in_enum_decl.swift
./test/IDE/complete_overridden_decls.swift
./test/IDE/complete_repl_empty_file.swift
./test/IDE/complete_swift_key_path.swift
./test/IDE/complete_func_no_closing_brace_at_eof_1.swift
./test/IDE/coloring_string_interpolation.swift
./test/IDE/complete_annotation.swift
./test/IDE/compatibility_alias.swift
./test/IDE/complete_operator_operand.swift
./test/IDE/complete_doc_keyword.swift
./test/IDE/complete_init_inherited.swift
./test/IDE/complete_pound_decl.swift
./test/IDE/complete_property_delegate_attribute.swift
./test/IDE/complete_member_type.swift
./test/IDE/print_module_without_deinit.swift
./test/IDE/complete_from_reexport.swift
./test/IDE/print_types.swift
./test/IDE/reconstruct_type_from_mangled_name_invalid.swift
./test/IDE/complete_unwrapping_if_while.swift
./test/IDE/complete_string_interpolation.swift
./test/IDE/test-input-complete
./test/IDE/test-input-complete/test_input.swift
./test/IDE/test-input-complete/Inputs
./test/IDE/test-input-complete/Inputs/func_incomplete12.swift
./test/IDE/test-input-complete/Inputs/toplevel_complete.swift
./test/IDE/test-input-complete/Inputs/func_incomplete1.swift
./test/IDE/test-input-complete/Inputs/toplevel_incomplete3.swift
./test/IDE/test-input-complete/Inputs/func_incomplete3.swift
./test/IDE/test-input-complete/Inputs/func_incomplete10.swift
./test/IDE/test-input-complete/Inputs/type_incomplete4.swift
./test/IDE/test-input-complete/Inputs/nominal_incomplete.swift
./test/IDE/test-input-complete/Inputs/func_incomplete7.swift
./test/IDE/test-input-complete/Inputs/func_incomplete5.swift
./test/IDE/test-input-complete/Inputs/toplevel_incomplete5.swift
./test/IDE/test-input-complete/Inputs/nominal_incomplete3.swift
./test/IDE/test-input-complete/Inputs/type_incomplete2.swift
./test/IDE/test-input-complete/Inputs/func_incomplete2.swift
./test/IDE/test-input-complete/Inputs/toplevel_incomplete2.swift
./test/IDE/test-input-complete/Inputs/func_incomplete11.swift
./test/IDE/test-input-complete/Inputs/func_complete.swift
./test/IDE/test-input-complete/Inputs/switch_incomplete.swift
./test/IDE/test-input-complete/Inputs/nominal_incomplete2.swift
./test/IDE/test-input-complete/Inputs/toplevel_incomplete4.swift
./test/IDE/test-input-complete/Inputs/func_incomplete4.swift
./test/IDE/test-input-complete/Inputs/type_incomplete3.swift
./test/IDE/test-input-complete/Inputs/err_type_complete.swift
./test/IDE/test-input-complete/Inputs/type_incomplete1.swift
./test/IDE/test-input-complete/Inputs/func_incomplete6.swift
./test/IDE/test-input-complete/Inputs/multi_line_string3.swift
./test/IDE/test-input-complete/Inputs/func_incomplete8.swift
./test/IDE/test-input-complete/Inputs/multi_line_string1.swift
./test/IDE/test-input-complete/Inputs/switch_incomplete3.swift
./test/IDE/test-input-complete/Inputs/toplevel_incomplete.swift
./test/IDE/test-input-complete/Inputs/nominal_complete.swift
./test/IDE/test-input-complete/Inputs/func_incomplete9.swift
./test/IDE/test-input-complete/Inputs/multi_line_string2.swift
./test/IDE/test-input-complete/Inputs/invalid_interpolation1.swift
./test/IDE/test-input-complete/Inputs/for_incomplete1.swift
./test/IDE/test-input-complete/Inputs/switch_incomplete2.swift
./test/IDE/comment_inherited_protocol.swift
./test/IDE/complete_type_in_func_param.swift
./test/IDE/complete_call_as_function.swift
./test/IDE/complete_vararg.swift
./test/IDE/complete_import.swift
./test/IDE/infer_import_as_member.swift
./test/IDE/complete_unqualified_lookup.swift
./test/IDE/dump_swift_lookup_tables_objc.swift
./test/IDE/structure.swift
./test/IDE/complete_func_no_closing_brace_at_eof_3.swift
./test/IDE/print_ast_non_typechecked.swift
./test/IDE/complete_in_closures.swift
./test/IDE/range_info_string_interpolation.swift
./test/IDE/complete_enum_elements.swift
./test/IDE/complete_repl_in_func_1.swift
./test/IDE/module_api_smoketest.swift
./test/IDE/complete_member_decls_from_parent_decl_context.swift
./test/IDE/complete_type_subscript.swift
./test/IDE/complete_multiple_trailingclosure.swift
./test/IDE/print_source_file_interface_preserve.swift
./test/IDE/complete_overlaymodule.swift
./test/IDE/coloring_configs.swift
./test/IDE/annotation_foundation.swift
./test/IDE/print_module_bad_target.swift
./test/IDE/complete_pound_selector.swift
./test/IDE/complete_testable.swift
./test/IDE/complete_at_eof_in_call_1.swift
./test/IDE/print_omit_needless_words.swift
./test/IDE/range_info_basics.swift
./test/IDE/complete_trailing_closure.swift
./test/IDE/import_as_member.swift
./test/IDE/complete_import_overloads.swift
./test/IDE/complete_super_self.swift
./test/IDE/coloring.swift
./test/IDE/comment_measurement.swift
./test/IDE/complete_with_visible_members.swift
./test/IDE/print_clang_foundation.swift
./test/IDE/range_info_54276140.swift
./test/IDE/complete_name_lookup.swift
./test/IDE/complete_property_delegate.swift
./test/IDE/complete_from_clang_importer_framework.swift
./test/IDE/print_clang_framework_with_overlay.swift
./test/IDE/print_clang_bool_bridging.swift
./test/IDE/print_usrs_invalid.swift
./test/IDE/comment_attach.swift
./test/IDE/complete_keypath_member_lookup.swift
./test/IDE/reconstruct_type_from_mangled_name_import.swift
./test/IDE/complete_lazy_initialized_var.swift
./test/IDE/complete_import_swiftmodule.swift
./test/IDE/complete_unresolved_members.swift
./test/IDE/complete_from_clang_framework.swift
./test/IDE/complete_value_expr.swift
./test/IDE/expr_type_filtered.swift
./test/IDE/complete_attributes.swift
./test/IDE/complete_decl_attribute.swift
./test/IDE/conforming-methods-afterclosure.swift
./test/IDE/repl_complete_with_error.swift
./test/IDE/complete_with_multiple_imports.swift
./test/IDE/complete_rdar63965160.swift
./test/IDE/print_clang_header_availability.swift
./test/IDE/print_clang_ObjectiveC.swift
./test/IDE/print_property_wrappers.swift
./test/IDE/print_synthesized_extensions_nomerge.swift
./test/IDE/range_info_branches.swift
./test/IDE/complete_expr_tuple.swift
./test/IDE/complete_pound_directive.swift
./test/IDE/coloring_comments.swift
./test/IDE/complete_pound_statement.swift
./test/IDE/print_ast_tc_decls.swift
./test/IDE/complete_loop.swift
./test/IDE/complete_multiple_trailingclosure_signatures.swift
./test/IDE/complete_from_swift_module.swift
./test/IDE/newtype.swift
./test/IDE/complete_controltransfer.swift
./test/IDE/reconstruct_type_from_mangled_name.swift
./test/IDE/complete_cache.swift
./test/IDE/complete_at_eof_1.swift
./test/IDE/typecontext_basic.swift
./test/IDE/complete_at_eof_no_newline_1.swift
./test/IDE/complete_value_literals.swift
./test/IDE/complete_return.swift
./test/IDE/complete_override_objc.swift
./test/IDE/complete_override_access_control_class.swift
./test/IDE/print_stdlib.swift
./test/IDE/complete_after_self.swift
./test/IDE/int.complete_type_any.swift.tmp.types.txt
./test/IDE/comment_inherited_class.swift
./test/IDE/comment_extensions.swift
./test/IDE/print_clang_header_i386.swift
./test/IDE/print_ast_interface.swift
./test/IDE/complete_override_access_control_protocol.swift
./test/IDE/complete_type.swift
./test/IDE/clang-importing
./test/IDE/clang-importing/complete_with_clang_comments.swift
./test/IDE/clang-importing/Inputs
./test/IDE/clang-importing/Inputs/bridge.h
./test/IDE/clang-importing/Inputs/somemod1
./test/IDE/clang-importing/Inputs/somemod1/somemod1.h
./test/IDE/clang-importing/Inputs/somemod1/module.modulemap
./test/IDE/clang-importing/Inputs/somemod2
./test/IDE/clang-importing/Inputs/somemod2/somemod2.h
./test/IDE/clang-importing/Inputs/somemod2/module.modulemap
./test/IDE/print_source_file_interface_1.swift
./test/IDE/complete_func_reference.swift
./test/IDE/complete_sself.swift
./test/IDE/complete_call_arg.swift
./test/IDE/complete_assignment.swift
./test/IDE/complete_members_optional.swift
./test/IDE/complete_from_swiftonly_systemmodule.swift
./test/IDE/print_module_missing.swift
./test/IDE/complete_multifile.swift
./test/IDE/complete_without_typo_correction.swift
./test/IDE/dump_swift_lookup_tables.swift
./test/IDE/complete_skipbody.swift
./test/IDE/complete_accessor.swift
./test/IDE/print_clang_framework.swift
./test/IDE/complete_generic_param.swift
./test/IDE/import_as_member_cf.swift
./test/IDE/complete_generic_optional.swift
./test/IDE/complete_override.swift
./test/IDE/comment_brief.swift
./test/IDE/print_source_file_interface_preserve.swift.result
./test/IDE/complete_func_no_closing_brace_deinit.swift
./test/IDE/complete_stdlib_optional_objc.swift
./test/IDE/complete_pound_expr.swift
./test/IDE/print_swift_module_with_available.swift
./test/IDE/complete_cross_import_no_underscore.swift
./test/IDE/range_info_declattr.swift
./test/IDE/comment_to_xml.swift
./test/IDE/importProtocols.swift
./test/IDE/local_types.swift
./test/IDE/complete_operators.swift
./test/IDE/print_synthesized_extensions.swift
./test/IDE/print_swift_module.swift
./test/IDE/coloring_playground.swift
./test/IDE/complete_invalid_op_decl.swift
./test/IDE/complete_constructor.swift
./test/IDE/complete_precedencegroup.swift
./test/IDE/coloring_invalid.swift
./test/IDE/complete_in_accessors.swift
./test/IDE/print_ast_tc_decls_errors.swift
./test/IDE/sdk_sugar.swift
./test/IDE/enable_objc_interop.swift
./test/IDE/complete_unicode.swift
./test/IDE/comment_attach_huge.swift
./test/IDE/structure_object_literals.swift
./test/IDE/complete_at_start_1.swift
./test/IDE/complete_at_eof_no_newline_2.swift
./test/IDE/conforming-methods-basic.swift
./test/IDE/complete_func_body_typechecking.swift
./test/IDE/complete_uninferred_generic.swift
./test/IDE/complete_expr_postfix_begin.swift
./test/IDE/annotation.swift
./test/IDE/print_source_file_interface_2.swift.result
./test/IDE/complete_constrained.swift
./test/IDE/coloring_keywords.swift
./test/IDE/complete_default_arguments.swift
./test/IDE/complete_cross_import_no_underscore_imported.swift
./test/IDE/print_type_interface.swift
./test/IDE/complete_repl_identifier_prefix_1.swift
./test/IDE/complete_from_stdlib.swift
./test/IDE/Inputs
./test/IDE/Inputs/swift_name.h
./test/IDE/Inputs/swift_name_objc.h
./test/IDE/Inputs/foo_swift_module_overlay.swift
./test/IDE/Inputs/multiple-files-1.swift
./test/IDE/Inputs/category-ordering
./test/IDE/Inputs/category-ordering/ProtocolThenProperty.h
./test/IDE/Inputs/category-ordering/module.map
./test/IDE/Inputs/category-ordering/PropertyThenProtocol.h
./test/IDE/Inputs/complete_testable_helper.swift
./test/IDE/Inputs/header.h
./test/IDE/Inputs/EnumFromOtherFile.swift
./test/IDE/Inputs/complete_import_multifile2.swift
./test/IDE/Inputs/multiple-files-2.swift
./test/IDE/Inputs/complete_import_overloads.swift
./test/IDE/Inputs/print_clang_header
./test/IDE/Inputs/print_clang_header/header-to-print.h.printed.txt
./test/IDE/Inputs/print_clang_header/header-to-print-availability.h
./test/IDE/Inputs/print_clang_header/header-to-print-availability.h.module.printed.txt
./test/IDE/Inputs/print_clang_header/Foo.modulemap
./test/IDE/Inputs/print_clang_header/header-to-print.h
./test/IDE/Inputs/print_clang_header/header-to-print.h.module.printed.txt
./test/IDE/Inputs/print_clang_header/header-to-print.h.command-line-include.printed.txt
./test/IDE/Inputs/print_clang_header/Foo-vfsoverlay.yaml
./test/IDE/Inputs/print_clang_header/other-header.h
./test/IDE/Inputs/print_clang_header/module.modulemap
./test/IDE/Inputs/print_clang_header/header-to-print-availability.h.printed.txt
./test/IDE/Inputs/foo_swift_module.printed.comments.txt
./test/IDE/Inputs/ExprType.swift
./test/IDE/Inputs/FooOverlay.swift
./test/IDE/Inputs/mock-sdk
./test/IDE/Inputs/mock-sdk/Foo.annotated.txt
./test/IDE/Inputs/mock-sdk/Foo.printed.txt
./test/IDE/Inputs/mock-sdk/SwiftNameTests.framework
./test/IDE/Inputs/mock-sdk/SwiftNameTests.framework/module.map
./test/IDE/Inputs/mock-sdk/SwiftNameTests.framework/Headers
./test/IDE/Inputs/mock-sdk/SwiftNameTests.framework/Headers/SwiftNameTests.h
./test/IDE/Inputs/mock-sdk/Foo.framework
./test/IDE/Inputs/mock-sdk/Foo.framework/module.map
./test/IDE/Inputs/mock-sdk/Foo.framework/Headers
./test/IDE/Inputs/mock-sdk/Foo.framework/Headers/Foo.h
./test/IDE/Inputs/mock-sdk/Foo.framework/Frameworks
./test/IDE/Inputs/mock-sdk/Foo.framework/Frameworks/FooSub.framework
./test/IDE/Inputs/mock-sdk/Foo.framework/Frameworks/FooSub.framework/Headers
./test/IDE/Inputs/mock-sdk/Foo.framework/Frameworks/FooSub.framework/Headers/FooSub.h
./test/IDE/Inputs/mock-sdk/OverlayTest.swiftinterface
./test/IDE/Inputs/mock-sdk/FooHelper.framework
./test/IDE/Inputs/mock-sdk/FooHelper.framework/module.map
./test/IDE/Inputs/mock-sdk/FooHelper.framework/Headers
./test/IDE/Inputs/mock-sdk/FooHelper.framework/Headers/FooHelperExplicit.h
./test/IDE/Inputs/mock-sdk/FooHelper.framework/Headers/FooHelper.h
./test/IDE/Inputs/mock-sdk/FooHelper.framework/Frameworks
./test/IDE/Inputs/mock-sdk/FooHelper.framework/Frameworks/FooHelperSub.framework
./test/IDE/Inputs/mock-sdk/FooHelper.framework/Frameworks/FooHelperSub.framework/Headers
./test/IDE/Inputs/mock-sdk/FooHelper.framework/Frameworks/FooHelperSub.framework/Headers/FooHelperSub.h
./test/IDE/Inputs/mock-sdk/Foo.FooSub.printed.txt
./test/IDE/Inputs/mock-sdk/FooHelper.FooHelperSub.printed.txt
./test/IDE/Inputs/mock-sdk/OverlayTest.framework
./test/IDE/Inputs/mock-sdk/OverlayTest.framework/Headers
./test/IDE/Inputs/mock-sdk/OverlayTest.framework/Headers/Overlayed.h
./test/IDE/Inputs/mock-sdk/OverlayTest.framework/Headers/OverlayTest.h
./test/IDE/Inputs/mock-sdk/OverlayTest.framework/Modules
./test/IDE/Inputs/mock-sdk/OverlayTest.framework/Modules/module.modulemap
./test/IDE/Inputs/mock-sdk/Foo.printed.recursive.txt
./test/IDE/Inputs/mock-sdk/FooHelper.printed.txt
./test/IDE/Inputs/mock-sdk/Bar.framework
./test/IDE/Inputs/mock-sdk/Bar.framework/module.map
./test/IDE/Inputs/mock-sdk/Bar.framework/Headers
./test/IDE/Inputs/mock-sdk/Bar.framework/Headers/Bar.h
./test/IDE/Inputs/mock-sdk/BoolBridgingTests.framework
./test/IDE/Inputs/mock-sdk/BoolBridgingTests.framework/module.map
./test/IDE/Inputs/mock-sdk/BoolBridgingTests.framework/Headers
./test/IDE/Inputs/mock-sdk/BoolBridgingTests.framework/Headers/BoolBridgingTests.h
./test/IDE/Inputs/mock-sdk/FooHelper.FooHelperExplicit.printed.txt
./test/IDE/Inputs/comment_extensions.swift
./test/IDE/Inputs/corrupted_module.swiftmodule
./test/IDE/Inputs/CrossImport
./test/IDE/Inputs/CrossImport/C.swiftinterface
./test/IDE/Inputs/CrossImport/_ABAdditions.swiftinterface
./test/IDE/Inputs/CrossImport/D.swiftinterface
./test/IDE/Inputs/CrossImport/B.swiftinterface
./test/IDE/Inputs/CrossImport/DBAdditions.swiftinterface
./test/IDE/Inputs/CrossImport/A.swiftinterface
./test/IDE/Inputs/CrossImport/A.swiftcrossimport
./test/IDE/Inputs/CrossImport/A.swiftcrossimport/B.swiftoverlay
./test/IDE/Inputs/CrossImport/_ABAdditions.swiftcrossimport
./test/IDE/Inputs/CrossImport/_ABAdditions.swiftcrossimport/D.swiftoverlay
./test/IDE/Inputs/CrossImport/D.swiftcrossimport
./test/IDE/Inputs/CrossImport/D.swiftcrossimport/B.swiftoverlay
./test/IDE/Inputs/CrossImport/__ABAdditionsDAdditions.swiftinterface
./test/IDE/Inputs/custom-modules
./test/IDE/Inputs/custom-modules/ImportedProtocols.h
./test/IDE/Inputs/custom-modules/ImportAsMemberClass.h
./test/IDE/Inputs/custom-modules/OmitNeedlessWords.h
./test/IDE/Inputs/custom-modules/CollisionImportAsMember.h
./test/IDE/Inputs/custom-modules/ImportAsMemberC.h
./test/IDE/Inputs/custom-modules/module.map
./test/IDE/Inputs/custom-modules/NewtypeObjC.h
./test/IDE/Inputs/custom-modules/ImportAsMemberB.h
./test/IDE/Inputs/custom-modules/ImportAsMemberError.h
./test/IDE/Inputs/custom-modules/InferImportAsMember.h
./test/IDE/Inputs/custom-modules/ImportAsMember.apinotes
./test/IDE/Inputs/custom-modules/ImportAsMember.h
./test/IDE/Inputs/custom-modules/Newtype.h
./test/IDE/Inputs/custom-modules/ImportAsMemberAPINotes.h
./test/IDE/Inputs/custom-modules/CompatibilityAlias.h
./test/IDE/Inputs/precedencegroup_multifile.swift
./test/IDE/Inputs/reconstruct_type_helper.h
./test/IDE/Inputs/foo_swift_module.swift
./test/IDE/Inputs/ExprTypeFiltered.swift
./test/IDE/Inputs/local_types.swift
./test/IDE/Inputs/print_clang_header_swift_name.h
./test/IDE/Inputs/AnyObject
./test/IDE/Inputs/AnyObject/bar_swift_module.swift
./test/IDE/Inputs/AnyObject/module.map
./test/IDE/Inputs/AnyObject/baz_clang_module.h
./test/IDE/Inputs/AnyObject/foo_swift_module.swift
./test/IDE/complete_from_clang_framework_typechecker.swift
./test/IDE/complete_not_recommended.swift
./test/IDE/complete_override_typealias.swift
./test/IDE/complete_override_extension.swift
./test/IDE/print_source_file_interface_2.swift
./test/IDE/print_clang_swift_name.swift
./test/Misc
./test/Misc/fatal_error.swift
./test/Misc/serialized-diagnostics-file.swift
./test/Misc/serialized-diagnostics-interpret-mode.swift
./test/Misc/stats_dir_instructions.swift
./test/Misc/serialized-diagnostics.swift
./test/Misc/stats_dir_tracer.swift
./test/Misc/misc_diagnostics.swift
./test/Misc/dump_api.swift
./test/Misc/serialized-diagnostics-batch-mode.swift
./test/Misc/stats_dir_failure_count.swift
./test/Misc/target-cpu.swift
./test/Misc/stats_dir_long_path_name.swift
./test/Misc/stats_dir_profiler.swift
./test/Misc/serialized-diagnostics-batch-mode-primary-errors.swift
./test/Misc/expression_too_complex_2.swift
./test/Misc/stats_max_determinism.swift
./test/Misc/opt-debug-forbid-typecheck-prefix.swift
./test/Misc/you-should-be-using-LLVM_DEBUG.test-sh
./test/Misc/floatTruncation.swift
./test/Misc/stats_dir_module_interface.swift
./test/Misc/serialized-diagnostics-batch-mode-nonprimary-errors-only.swift
./test/Misc/expression_too_complex_3.swift
./test/Misc/stats_dir.swift
./test/Misc/tbi.sil
./test/Misc/Inputs
./test/Misc/Inputs/serialized-diagnostics-batch-mode-suppression-helper.swift
./test/Misc/Inputs/dumped_api.swift
./test/Misc/Inputs/serialized-diagnostics-batch-mode-helper.swift
./test/Misc/Inputs/empty.swiftinterface
./test/Misc/Inputs/serialized-diagnostics-batch-mode-other.swift
./test/Misc/stats_dir_plausible_maxrss.swift
./test/Misc/prioritize_solver_memory_threshold.swift
./test/Migrator
./test/Migrator/stdlib_rename.swift.expected
./test/Migrator/rename-init.swift
./test/Migrator/pre_fixit_pass.swift
./test/Migrator/no_double_edit_ast_pass.swift.expected
./test/Migrator/rename-init.swift.expected
./test/Migrator/string-representable.swift
./test/Migrator/rdar31892850.swift
./test/Migrator/avoid_insert_existing_functions.swift
./test/Migrator/stdlib_rename.swift
./test/Migrator/pre_fixit_pass.swift.expected
./test/Migrator/fixit-NSObject-hashValue.swift
./test/Migrator/property.swift
./test/Migrator/string-representable.swift.expected
./test/Migrator/override_migration.swift
./test/Migrator/no_extraneous_argument_labels.swift.expected
./test/Migrator/property.swift.expected
./test/Migrator/double_fixit_ok.swift.expected
./test/Migrator/missing_script.swift
./test/Migrator/function-hoist.swift
./test/Migrator/double_fixit_ok.swift
./test/Migrator/fixit_flatMap.swift
./test/Migrator/never_compiles_safely_exits.swift
./test/Migrator/wrap_optional.swift.expected
./test/Migrator/substring_to_string_conversion.swift
./test/Migrator/rename_cross_file.swift
./test/Migrator/fixit_flatMap.swift.expected
./test/Migrator/always_remove_old_remap_file.swift
./test/Migrator/remove_override.swift
./test/Migrator/pre_fixit_pass_still_failed.swift
./test/Migrator/avoid_insert_existing_functions.swift.expected
./test/Migrator/null_migration.swift
./test/Migrator/optional_try_migration.swift
./test/Migrator/wrap_optional.swift
./test/Migrator/no_ast_passes_after_swift4.swift.expected
./test/Migrator/remove_override.swift.expected
./test/Migrator/member.swift
./test/Migrator/api-special-cases.swift.expected
./test/Migrator/qualified-replacement.swift
./test/Migrator/qualified-replacement.swift.expected
./test/Migrator/invalid_sourceloc.swift
./test/Migrator/rename_cross_file.swift.expected
./test/Migrator/no_ast_passes_after_swift4.swift
./test/Migrator/no_duplicate_aarch64_use_tbi.swift
./test/Migrator/rename-func-decl.swift.expected
./test/Migrator/mock-sdk
./test/Migrator/mock-sdk/TestMyTime.framework
./test/Migrator/mock-sdk/TestMyTime.framework/Headers
./test/Migrator/mock-sdk/TestMyTime.framework/Headers/TestMyTime.apinotes
./test/Migrator/mock-sdk/TestMyTime.framework/Headers/MyTime.h
./test/Migrator/mock-sdk/TestMyTime.framework/Headers/TestMyTime.h
./test/Migrator/mock-sdk/TestMyTime.framework/Modules
./test/Migrator/mock-sdk/TestMyTime.framework/Modules/module.modulemap
./test/Migrator/mock-sdk/Bar.framework
./test/Migrator/mock-sdk/Bar.framework/module.map
./test/Migrator/mock-sdk/Bar.framework/Headers
./test/Migrator/mock-sdk/Bar.framework/Headers/Bar.h
./test/Migrator/no_extraneous_argument_labels.swift
./test/Migrator/rename.swift
./test/Migrator/post_fixit_pass.swift.expected
./test/Migrator/substring_to_string_conversion.swift.expected
./test/Migrator/call_expr_result.swift
./test/Migrator/member.swift.expected
./test/Migrator/call_expr_result.swift.expected
./test/Migrator/no_double_edit_ast_pass.swift
./test/Migrator/api-diff-data-dir.swift
./test/Migrator/optional_try_migration.swift.expected
./test/Migrator/swift_version_change.swift
./test/Migrator/no_var_to_let.swift
./test/Migrator/post_fixit_pass.swift
./test/Migrator/insert_replace_fixit.swift.expected
./test/Migrator/insert_replace_fixit.swift
./test/Migrator/fixit-NSObject-hashValue.swift.expected
./test/Migrator/rename-func-decl.swift
./test/Migrator/function-hoist.swift.expected
./test/Migrator/Inputs
./test/Migrator/Inputs/DoubleEditAPI.json
./test/Migrator/Inputs/API.json
./test/Migrator/Inputs/objc_inference.swift
./test/Migrator/Inputs/api-diff-data-dir
./test/Migrator/Inputs/api-diff-data-dir/overlay4.json
./test/Migrator/Inputs/api-diff-data-dir/watchos4.json
./test/Migrator/Inputs/api-diff-data-dir/tvos4.json
./test/Migrator/Inputs/api-diff-data-dir/tvos3.json
./test/Migrator/Inputs/api-diff-data-dir/watchos3.json
./test/Migrator/Inputs/api-diff-data-dir/overlay3.json
./test/Migrator/Inputs/api-diff-data-dir/macos4.json
./test/Migrator/Inputs/api-diff-data-dir/ios3.json
./test/Migrator/Inputs/api-diff-data-dir/ios4.json
./test/Migrator/Inputs/api-diff-data-dir/macos3.json
./test/Migrator/Inputs/substring_to_string_conversion.swift
./test/Migrator/Inputs/MyAppKit.swift
./test/Migrator/Inputs/override.json
./test/Migrator/Inputs/no_duplicate_aarch64_use_tbi_ofm.json
./test/Migrator/Inputs/conservative_objc_inference.swift
./test/Migrator/Inputs/rename_cross_file_2.swift
./test/Migrator/Inputs/MySwift.swift
./test/Migrator/Inputs/Cities.swift
./test/Migrator/Inputs/SpecialCaseAPI.json
./test/Migrator/Inputs/qualified.json
./test/Migrator/Inputs/API-function-hoist.json
./test/Migrator/Inputs/objc_inference_cross_file_B.swift
./test/Migrator/Inputs/CallExpr.json
./test/Migrator/Inputs/string-representable.json
./test/Migrator/Inputs/never_compiles_safely_exits_breaking_code.swift
./test/Migrator/Inputs/objc_inference_cross_file_A.swift
./test/Migrator/rename.swift.expected
./test/Migrator/api-special-cases.swift
./test/SILOptimizer
./test/SILOptimizer/dse_with_union.swift
./test/SILOptimizer/closure_specialize_fragile.sil
./test/SILOptimizer/eager_specialize.sil
./test/SILOptimizer/looprotate.sil
./test/SILOptimizer/arcsequenceopts_loops.sil
./test/SILOptimizer/spec_conf2.swift
./test/SILOptimizer/devirt_default_witness_method.sil
./test/SILOptimizer/silcombine_runtime_crash.swift
./test/SILOptimizer/inline_generics.sil
./test/SILOptimizer/keypath_opt_crash.swift
./test/SILOptimizer/specialization_and_resilience.swift
./test/SILOptimizer/illegal_escaping_address.swift
./test/SILOptimizer/switch_enum_resilient.swift
./test/SILOptimizer/stack_promotion_2_modules.swift
./test/SILOptimizer/definite_init_markuninitialized_var.sil
./test/SILOptimizer/sil_witness_tables_external_witnesstable.swift
./test/SILOptimizer/access_marker_verify_objc.swift
./test/SILOptimizer/access_enforcement_selection.swift
./test/SILOptimizer/optimize_never.sil
./test/SILOptimizer/polymorphic_builtins.sil
./test/SILOptimizer/definite_init_inout_super_init.swift
./test/SILOptimizer/alive_method_with_thunk.swift
./test/SILOptimizer/globalopt_resilience.swift
./test/SILOptimizer/sil_simplify_instrs.sil
./test/SILOptimizer/diagnostic_constant_propagation_floats_x86.sil
./test/SILOptimizer/di_property_wrappers.swift
./test/SILOptimizer/loop_unroll.sil
./test/SILOptimizer/loweraggregateinstrs_resilience.sil
./test/SILOptimizer/capture_promotion.sil
./test/SILOptimizer/inline_generic_coroutines.swift
./test/SILOptimizer/predictable_memopt_unreferenceable_storage.swift
./test/SILOptimizer/zeroInitializer.swift
./test/SILOptimizer/access_marker_verify.swift
./test/SILOptimizer/verifier_reject.sil
./test/SILOptimizer/sil_combine_enum_addr.sil
./test/SILOptimizer/for_each_loop_unroll_test.swift
./test/SILOptimizer/constant_evaluator_test.sil
./test/SILOptimizer/dead_alloc_elim.sil
./test/SILOptimizer/arcsequenceopts_rcidentityanalysis.sil
./test/SILOptimizer/redundant_load_elim.sil
./test/SILOptimizer/stack_promotion_crash.swift
./test/SILOptimizer/devirtualize_inlinable_mandatory.swift
./test/SILOptimizer/sroa_unreferenced_members.swift
./test/SILOptimizer/devirt_base_class.swift
./test/SILOptimizer/sil_combine_concrete_existential.sil
./test/SILOptimizer/devirt_inherited_conformance.swift
./test/SILOptimizer/wrong_cow_arrayopt.swift
./test/SILOptimizer/cse_apply.sil
./test/SILOptimizer/bug-reducer-tester-runtime-crasher.sil
./test/SILOptimizer/access_dom_overlap.sil
./test/SILOptimizer/function_order.sil
./test/SILOptimizer/sil_locations.swift
./test/SILOptimizer/mem2reg_unreachable.sil
./test/SILOptimizer/existential_metatype.swift
./test/SILOptimizer/remove_unused_global_vars.swift
./test/SILOptimizer/cross-module-optimization-objc.swift
./test/SILOptimizer/castoptimizer-wrongscope.swift
./test/SILOptimizer/existential_specializer_indirect_class.sil
./test/SILOptimizer/closure_specialize_dynamic_self.swift
./test/SILOptimizer/bridged_casts_folding.sil
./test/SILOptimizer/escape_analysis.sil
./test/SILOptimizer/mandatory_inlining_devirt.swift
./test/SILOptimizer/devirt_static_covariant_return.swift
./test/SILOptimizer/devirt_alloc_ref_dynamic_ownership.sil
./test/SILOptimizer/diagnostic_constant_propagation_int_arch32.swift
./test/SILOptimizer/cse_metatype_conformance.swift
./test/SILOptimizer/simplify_cfg_address_phi.sil
./test/SILOptimizer/array_count_propagation.sil
./test/SILOptimizer/access_summary_analysis.sil
./test/SILOptimizer/definite_init_crashes.sil
./test/SILOptimizer/diagnostic_constant_propagation-swift4.swift
./test/SILOptimizer/exclusivity_static_diagnostics.swift
./test/SILOptimizer/dead_code_elimination.sil
./test/SILOptimizer/cyclic_entry.sil
./test/SILOptimizer/global_hoisting_crash.swift
./test/SILOptimizer/capture_promotion_ownership.swift
./test/SILOptimizer/unused_containers.swift
./test/SILOptimizer/opt_mode.swift
./test/SILOptimizer/mem-behavior.sil
./test/SILOptimizer/specialize_reabstraction.sil
./test/SILOptimizer/inliner_loop.swift
./test/SILOptimizer/inline_semantics.sil
./test/SILOptimizer/devirtualize_protocol_composition.swift
./test/SILOptimizer/sr-5068.sil
./test/SILOptimizer/access_enforcement_fastpath.sil
./test/SILOptimizer/loweraggregateinstrs_expandall.sil
./test/SILOptimizer/select_enum_addr_reads_memory.sil
./test/SILOptimizer/ownership_model_eliminator.sil
./test/SILOptimizer/sil_combine_concrete_existential.swift
./test/SILOptimizer/existential_type_propagation.sil
./test/SILOptimizer/exclusivity_static_diagnostics_inlined.swift
./test/SILOptimizer/no-external-defs-onone.sil
./test/SILOptimizer/alias-crash.sil
./test/SILOptimizer/capture_promotion_generic_context_ownership.sil
./test/SILOptimizer/cast_folding_objc_generics.swift
./test/SILOptimizer/specialize.sil
./test/SILOptimizer/access_dom_loop.sil
./test/SILOptimizer/specialize_opaque_type_archetypes_multifile.swift
./test/SILOptimizer/devirt_override.sil
./test/SILOptimizer/caller_analysis.sil
./test/SILOptimizer/sil_combine_devirt.sil
./test/SILOptimizer/noescape_param_exclusivity.swift
./test/SILOptimizer/loop_info_printer.sil
./test/SILOptimizer/simplify_cfg_jump_thread_crash.sil
./test/SILOptimizer/inline_late.sil
./test/SILOptimizer/functionsigopts_string_internal.swift
./test/SILOptimizer/linker.swift
./test/SILOptimizer/dead_func.swift
./test/SILOptimizer/devirt_contravariant_args.swift
./test/SILOptimizer/iv_info_printer.sil
./test/SILOptimizer/strip_debug_info.sil
./test/SILOptimizer/definite_init_markuninitialized_rootself.sil
./test/SILOptimizer/outliner.sil
./test/SILOptimizer/existential_transform_extras.sil
./test/SILOptimizer/array_element_propagation.sil
./test/SILOptimizer/access_wmo.sil
./test/SILOptimizer/sil_combine_global_addr.sil
./test/SILOptimizer/funcsig_deadarg_explode.sil
./test/SILOptimizer/devirt_type_subst_bug.swift
./test/SILOptimizer/inline_heuristics.sil
./test/SILOptimizer/devirt_generic_witness_method.sil
./test/SILOptimizer/specialize_self.swift
./test/SILOptimizer/curry-thunk-elimination.swift
./test/SILOptimizer/prespecialization_with_definition.sil
./test/SILOptimizer/definite_init_value_types.swift
./test/SILOptimizer/devirt_witness_method_empty_conformance.swift
./test/SILOptimizer/sil_combine_enums.sil
./test/SILOptimizer/di_property_wrappers_errors_multifile.swift
./test/SILOptimizer/sil_combine_apply.sil
./test/SILOptimizer/for_each_loop_unroll_test.sil
./test/SILOptimizer/access_enforcement_opts.sil
./test/SILOptimizer/partial_specialization.sil
./test/SILOptimizer/objectoutliner.sil
./test/SILOptimizer/cast_folding_conditional_conformance.swift
./test/SILOptimizer/funcsig_opaque.sil
./test/SILOptimizer/specialize_refined_adds_constraints.swift
./test/SILOptimizer/inline_devirtualize_specialize.sil
./test/SILOptimizer/cast_folding_objc_bridging_conditional.sil
./test/SILOptimizer/di-conditional-destroy-scope.swift
./test/SILOptimizer/cross-module-optimization.swift
./test/SILOptimizer/stack_promotion_array_literal.swift
./test/SILOptimizer/semantic-arc-opts.sil
./test/SILOptimizer/inline_deep.swift
./test/SILOptimizer/predictable_memopt_locs.swift
./test/SILOptimizer/constantprop-wrongscope.swift
./test/SILOptimizer/postdomtree_verification_crash.sil
./test/SILOptimizer/arcsequenceopts_uniquecheck.sil
./test/SILOptimizer/specialize_default_witness_resilience.sil
./test/SILOptimizer/dead_func_objc_extension_keypath.swift
./test/SILOptimizer/fold_enums.sil
./test/SILOptimizer/globalopt_let_propagation.swift
./test/SILOptimizer/super_init.swift
./test/SILOptimizer/lazy_property_getters.swift
./test/SILOptimizer/devirt_protocol_method_invocations.swift
./test/SILOptimizer/sil_combine_objc_bridge.sil
./test/SILOptimizer/devirt_jump_thread.sil
./test/SILOptimizer/specialize_opaque.sil
./test/SILOptimizer/rcidentity.sil
./test/SILOptimizer/let_properties_opts.sil
./test/SILOptimizer/return.swift
./test/SILOptimizer/split_critical_edges.sil
./test/SILOptimizer/stack_promotion_escaping.swift
./test/SILOptimizer/pound_assert.sil
./test/SILOptimizer/closure_specialize_consolidated.sil
./test/SILOptimizer/destroy_hoisting.sil
./test/SILOptimizer/bridged_casts_folding.swift
./test/SILOptimizer/access_dom.sil
./test/SILOptimizer/sr-4957.swift
./test/SILOptimizer/simplify_cfg_args.sil
./test/SILOptimizer/pure_apply.swift
./test/SILOptimizer/cow_opts.sil
./test/SILOptimizer/inline_thunk.swift
./test/SILOptimizer/mandatory_inlining_open_existential.sil
./test/SILOptimizer/global_init_with_empty.swift
./test/SILOptimizer/escape_analysis_dead_store.sil
./test/SILOptimizer/mandatory_inlining_circular.swift
./test/SILOptimizer/access_marker_mandatory.swift
./test/SILOptimizer/phi-expansion.sil
./test/SILOptimizer/bridged_casts_folding_ownership.sil
./test/SILOptimizer/protocol_lookup.swift
./test/SILOptimizer/mandatory_combiner.sil
./test/SILOptimizer/existential_specializer_soletype.sil
./test/SILOptimizer/definite_init_protocol_init.swift
./test/SILOptimizer/definite_init_failable_initializers_objc.swift
./test/SILOptimizer/optimize_keypath.swift
./test/SILOptimizer/loop-region-analysis.sil
./test/SILOptimizer/devirt_generic_witness_method_ownership.sil
./test/SILOptimizer/access_dom_call.sil
./test/SILOptimizer/dynamic_self_cast.sil
./test/SILOptimizer/constant_evaluable_subset_test_arch32.swift
./test/SILOptimizer/spec_conf1.swift
./test/SILOptimizer/constant_propagation_stdlib.swift
./test/SILOptimizer/remove_unused_func.sil
./test/SILOptimizer/access_wmo_diagnose.swift
./test/SILOptimizer/existential_spl_witness_method.swift
./test/SILOptimizer/specialize_same_type_constraint.swift
./test/SILOptimizer/spec_archetype_method.swift
./test/SILOptimizer/lslocation_type_only_expansion.sil
./test/SILOptimizer/mandatory_inlining_ownership2.sil
./test/SILOptimizer/predictable_memaccess_opts.sil
./test/SILOptimizer/sink.sil
./test/SILOptimizer/devirt_specialized_conformance.swift
./test/SILOptimizer/specialize_inherited.sil
./test/SILOptimizer/simplify_cfg.sil
./test/SILOptimizer/devirt_nested_class.swift
./test/SILOptimizer/peephole_thick_to_objc_metatype.sil
./test/SILOptimizer/capturepromotion-wrong-lexicalscope.swift
./test/SILOptimizer/access_enforcement_noescape.swift
./test/SILOptimizer/destructor_analysis.sil
./test/SILOptimizer/definite_init_diagnostics_globals.swift
./test/SILOptimizer/inlinecaches_objc.sil
./test/SILOptimizer/partial_specialization_debug.sil
./test/SILOptimizer/mem-behavior-all.sil
./test/SILOptimizer/DestructorAnalysis.swift
./test/SILOptimizer/definite_init_address_only_let.swift
./test/SILOptimizer/mm_inlinecaches_multiple.sil
./test/SILOptimizer/sil_combine_memopts.sil
./test/SILOptimizer/recursive_func.sil
./test/SILOptimizer/outliner.swift
./test/SILOptimizer/inline_cache_and_arc.swift
./test/SILOptimizer/diagnostic_constant_propagation_floats_x86.swift
./test/SILOptimizer/temp_rvalue_opt_ossa.sil
./test/SILOptimizer/global_property_opt_objc.sil
./test/SILOptimizer/side-effect.sil
./test/SILOptimizer/bridged_casts_crash.sil
./test/SILOptimizer/polymorphic_inline_caches.sil
./test/SILOptimizer/definite-init-try-in-self-init-argument.swift
./test/SILOptimizer/constant_propagation_objc.sil
./test/SILOptimizer/constant_propagation_ownership_objc.sil
./test/SILOptimizer/devirt_specialized_inherited_interplay.swift
./test/SILOptimizer/devirt_speculative.sil
./test/SILOptimizer/cast_folding.swift
./test/SILOptimizer/OSLogMandatoryOptTest.sil
./test/SILOptimizer/specialize_self_conforming_error.swift
./test/SILOptimizer/sil_combine_bitops.sil
./test/SILOptimizer/capture_promotion_generic_context.sil
./test/SILOptimizer/constant_propagation_castopt_analysis_invalidation.sil
./test/SILOptimizer/closure_lifetime_fixup_undef.swift
./test/SILOptimizer/functionsigopts.sil
./test/SILOptimizer/mandatory_inlining_ossa_to_non_ossa_objc.sil
./test/SILOptimizer/concat_string_literals.32.swift
./test/SILOptimizer/devirtualize_cast.swift
./test/SILOptimizer/definite_init_scalarization_test.sil
./test/SILOptimizer/deadargsignatureopt.sil
./test/SILOptimizer/pointer_conversion.swift
./test/SILOptimizer/basic-aa.sil
./test/SILOptimizer/predictable_deadalloc_elim.sil
./test/SILOptimizer/opaque_values_mandatory.sil
./test/SILOptimizer/di_property_wrappers_errors.swift
./test/SILOptimizer/global_property_opt.sil
./test/SILOptimizer/cast_optimizer_conditional_conformance.sil
./test/SILOptimizer/static_initializer.sil
./test/SILOptimizer/silgen_cleanup.sil
./test/SILOptimizer/devirt_access.sil
./test/SILOptimizer/cse.sil
./test/SILOptimizer/utf8_decoding_fastpath.swift
./test/SILOptimizer/devirt_try_apply_ownership.sil
./test/SILOptimizer/arcsequenceopts_casts.sil
./test/SILOptimizer/redundant_load_elim_with_casts.sil
./test/SILOptimizer/definite_init_extension.swift
./test/SILOptimizer/pgo_si_inlinelarge.swift
./test/SILOptimizer/temp_rvalue_opt.sil
./test/SILOptimizer/definite_init_diagnostics_objc.swift
./test/SILOptimizer/access_enforcement_selection.sil
./test/SILOptimizer/no_traps_in_dict_loopup.swift
./test/SILOptimizer/devirtualize_class_method.swift
./test/SILOptimizer/optimize_keypath_objc.swift
./test/SILOptimizer/copy_propagation.sil
./test/SILOptimizer/devirtualize2_ownership.sil
./test/SILOptimizer/sil_combiner_concrete_prop_all_args.sil
./test/SILOptimizer/simplify_switch_enum_objc.sil
./test/SILOptimizer/cast_folding_opaque.swift
./test/SILOptimizer/pgo_si_reduce.swift
./test/SILOptimizer/devirtualize1.swift
./test/SILOptimizer/static_strings.swift
./test/SILOptimizer/existential_transform_soletype.swift
./test/SILOptimizer/arcsequenceopts_loops.sil.gyb
./test/SILOptimizer/mem2reg_liveness.sil
./test/SILOptimizer/devirtualize.sil
./test/SILOptimizer/capture_promotion_reachability.sil
./test/SILOptimizer/alwaysemitintoclient.swift
./test/SILOptimizer/stack_promotion.sil
./test/SILOptimizer/dead_partial_apply_arg.swift
./test/SILOptimizer/specialize_opaque_type_archetypes.swift
./test/SILOptimizer/specialize_chain.swift
./test/SILOptimizer/access_enforcement_noescape_error.swift
./test/SILOptimizer/mandatory_inlining_dynamic_method.swift
./test/SILOptimizer/generalized_accessors.sil
./test/SILOptimizer/devirt_override_ownership.sil
./test/SILOptimizer/devirt_access.swift
./test/SILOptimizer/licm_and_global_addr.swift
./test/SILOptimizer/pa_removal.sil
./test/SILOptimizer/closure_lifetime_fixup.swift
./test/SILOptimizer/opened_archetype_operands_tracking.sil
./test/SILOptimizer/noreturn_folding.sil
./test/SILOptimizer/diagnostic_constant_propagation_floats.sil
./test/SILOptimizer/devirtualize_ownership.sil
./test/SILOptimizer/dead_inlined_func.swift
./test/SILOptimizer/mem2reg_resilient.sil
./test/SILOptimizer/simplify-cfg-stress-test.sil
./test/SILOptimizer/dead_method.swift
./test/SILOptimizer/objc_protocol_method.swift
./test/SILOptimizer/devirt_bound_generic.swift
./test/SILOptimizer/latecodemotion.sil
./test/SILOptimizer/access_sink.sil
./test/SILOptimizer/diagnostic_constant_propagation_floats.swift
./test/SILOptimizer/allocboxtostack_escape.swift
./test/SILOptimizer/enum_jump_thread.sil
./test/SILOptimizer/specialize_checked_cast_branch.swift
./test/SILOptimizer/hello-world.swift
./test/SILOptimizer/devirt_class_witness_method.sil
./test/SILOptimizer/generic_specialization_loops_detection_with_loops.swift
./test/SILOptimizer/devirt_default_case.swift
./test/SILOptimizer/cse_objc.sil
./test/SILOptimizer/allocbox_to_stack.sil
./test/SILOptimizer/closure_spec_and_inline.swift
./test/SILOptimizer/dead_internal_func.swift
./test/SILOptimizer/abcopts.sil
./test/SILOptimizer/bug-reducer-tester-miscompile.sil
./test/SILOptimizer/array_contentof_opt.swift
./test/SILOptimizer/definite_init.swift
./test/SILOptimizer/ref_elt_addr.sil
./test/SILOptimizer/no_opt.swift
./test/SILOptimizer/devirt_witness_method_conformance.swift
./test/SILOptimizer/constant_propagation.sil
./test/SILOptimizer/pass_printer.swift
./test/SILOptimizer/specialize_no_definition.sil
./test/SILOptimizer/dead_bridging_code.swift
./test/SILOptimizer/constant_propagation_diagnostics.swift
./test/SILOptimizer/basic-instruction-properties.sil
./test/SILOptimizer/funcsig_explode_heuristic.sil
./test/SILOptimizer/inliner_spa.sil
./test/SILOptimizer/let_properties_opts_runtime.swift
./test/SILOptimizer/let_propagation.swift
./test/SILOptimizer/capture_promotion_resilient.sil
./test/SILOptimizer/dead_array_elim.sil
./test/SILOptimizer/devirt_jump_thread_crasher.sil
./test/SILOptimizer/enum_payload_modification_opt.swift
./test/SILOptimizer/infinite_recursion_objc.swift
./test/SILOptimizer/inline_subclass_existential.swift
./test/SILOptimizer/specialize_partial_apply.swift
./test/SILOptimizer/devirt_concrete_subclass_of_generic_class.swift
./test/SILOptimizer/unsafebufferpointer.swift
./test/SILOptimizer/typed-access-tb-aa.sil
./test/SILOptimizer/devirt_access_ownership.sil
./test/SILOptimizer/loweraggregateinstrs.sil
./test/SILOptimizer/definite_init_markuninitialized_derivedself.sil
./test/SILOptimizer/licm.sil
./test/SILOptimizer/concat_string_literals.64.swift
./test/SILOptimizer/prune-vtables.sil
./test/SILOptimizer/super_method.swift
./test/SILOptimizer/high_level_licm.sil
./test/SILOptimizer/devirt_access_serialized.sil
./test/SILOptimizer/unexpected_error.sil
./test/SILOptimizer/devirt_value_metatypes.swift
./test/SILOptimizer/polymorphic_builtins_diagnostics.sil
./test/SILOptimizer/mandatory_conditional_compile_out_using_optionals.swift
./test/SILOptimizer/globalopt_resilience_testing.swift
./test/SILOptimizer/dead_array_elim.swift
./test/SILOptimizer/devirt_method_with_generic_params.swift
./test/SILOptimizer/specialize_dynamic_self.swift
./test/SILOptimizer/globalopt.sil
./test/SILOptimizer/callee_analysis_crash.swift
./test/SILOptimizer/definite-init-convert-to-escape.swift
./test/SILOptimizer/sil_combine_opaque.sil
./test/SILOptimizer/functionsigopts_self.swift
./test/SILOptimizer/constant_evaluable_subset_test_arch64.swift
./test/SILOptimizer/merge_cond_fail.sil
./test/SILOptimizer/performance_inliner.sil
./test/SILOptimizer/specialize_unconditional_checked_cast.swift
./test/SILOptimizer/inline_addressor.swift
./test/SILOptimizer/type_lowering_resilience.swift
./test/SILOptimizer/specialized_anyobject_conformance.swift
./test/SILOptimizer/constant_propagation2.sil
./test/SILOptimizer/constant_propagation_floats_x86.sil
./test/SILOptimizer/devirt_try_apply.sil
./test/SILOptimizer/devirt_release.sil
./test/SILOptimizer/recursive_single.sil
./test/SILOptimizer/generic_specialization_loops_detection_without_loops.swift
./test/SILOptimizer/fp_rounding.swift
./test/SILOptimizer/devirt_single_module_in_multiple_files.swift
./test/SILOptimizer/opt_enumerate.swift
./test/SILOptimizer/conditionforwarding.sil
./test/SILOptimizer/optional_of_existential.swift
./test/SILOptimizer/diagnostic_constant_propagation_floats_nonx86.swift
./test/SILOptimizer/sroa.sil
./test/SILOptimizer/inline_recursive.swift
./test/SILOptimizer/return_ownership.swift
./test/SILOptimizer/exclusivity_static_diagnostics.sil
./test/SILOptimizer/devirtualize_existential.swift
./test/SILOptimizer/definite_init_failable_initializers.swift
./test/SILOptimizer/array_mutable_assertonly.swift
./test/SILOptimizer/sil_combine_alloc_stack.swift
./test/SILOptimizer/pound_assert.swift
./test/SILOptimizer/diagnostic_constant_propagation.swift
./test/SILOptimizer/empty_collection_count.swift
./test/SILOptimizer/funcsig_pseudogenerics.sil
./test/SILOptimizer/specialize_recursive_generics.sil
./test/SILOptimizer/optionset.swift
./test/SILOptimizer/optimizer_counters.sil
./test/SILOptimizer/specialize_apply_conf.swift
./test/SILOptimizer/inliner_coldblocks.sil
./test/SILOptimizer/mandatory_inlining_resilience.sil
./test/SILOptimizer/escape_analysis_reduced.sil
./test/SILOptimizer/silcombine_aebox_miscompile.swift
./test/SILOptimizer/devirt_ctors_ownership.sil
./test/SILOptimizer/partial_apply_dynamic_type.swift
./test/SILOptimizer/dont_remove_dynamic_self_arg.swift
./test/SILOptimizer/cowarray_opt.sil
./test/SILOptimizer/definite_init_lvalue_let_witness_methods.swift
./test/SILOptimizer/ome_ignore_stdlib.sil
./test/SILOptimizer/diagnose_unreachable.sil
./test/SILOptimizer/super_class_method.swift
./test/SILOptimizer/capture_propagation_linkage.swift
./test/SILOptimizer/throw_inline.swift
./test/SILOptimizer/noreturn_folding_ownership.sil
./test/SILOptimizer/capture_propagation.sil
./test/SILOptimizer/sil_combine.sil
./test/SILOptimizer/cast_foldings.sil
./test/SILOptimizer/definite_init_cross_module_swift4.swift
./test/SILOptimizer/polymorphic_builtins_diagnostics.swift
./test/SILOptimizer/licm_exclusivity.swift
./test/SILOptimizer/late_release_hoisting.sil
./test/SILOptimizer/definite_init_cross_module.swift
./test/SILOptimizer/globalopt_global_propagation.swift
./test/SILOptimizer/functionsigopts_sroa.sil
./test/SILOptimizer/cast_folding_no_bridging.sil
./test/SILOptimizer/definite_init_existential_let.swift
./test/SILOptimizer/devirt_speculate.swift
./test/SILOptimizer/dead_alloc_stack.swift
./test/SILOptimizer/dead_func_init_method.sil
./test/SILOptimizer/OSLogConstantEvaluableTest.swift
./test/SILOptimizer/simplify_cfg_args_crash.sil
./test/SILOptimizer/destroy_hoisting_crash.swift
./test/SILOptimizer/cowarray_opt_crash.swift
./test/SILOptimizer/functionsigopts_crash.swift
./test/SILOptimizer/epilogue_release_dumper.sil
./test/SILOptimizer/functionsigopts_string_fileprivate.swift
./test/SILOptimizer/dont_broaden_cxx_address_only.sil
./test/SILOptimizer/generic_inline_self.swift
./test/SILOptimizer/earlycodemotion.sil
./test/SILOptimizer/high_level_cse.sil
./test/SILOptimizer/bridging_checked_cast.sil
./test/SILOptimizer/sil_combine_objc.sil
./test/SILOptimizer/pointer_conversion_linux.swift
./test/SILOptimizer/inline_begin_apply.sil
./test/SILOptimizer/globalopt-iter.sil
./test/SILOptimizer/assume_single_threaded.sil
./test/SILOptimizer/ownership-kind-dumper.sil
./test/SILOptimizer/closure_specialize.sil
./test/SILOptimizer/simplify_unreachable_containing_blocks.sil
./test/SILOptimizer/mandatory_nil_comparison_inlining.swift
./test/SILOptimizer/anyhashable_to_protocol.swift
./test/SILOptimizer/array_element_propagation_crash.swift
./test/SILOptimizer/unreachable_dealloc_stack.sil
./test/SILOptimizer/loop_canonicalizer.sil
./test/SILOptimizer/functionsigopts_trivial.sil
./test/SILOptimizer/specialize_metatypes_with_nondefault_representation.sil
./test/SILOptimizer/escape_analysis_release_hoisting.sil
./test/SILOptimizer/ome_non_transparent.sil
./test/SILOptimizer/infinite_recursion.swift
./test/SILOptimizer/character_literals.swift
./test/SILOptimizer/definite-init-wrongscope.swift
./test/SILOptimizer/assert_configuration.sil
./test/SILOptimizer/peephole_trunc_and_ext.sil
./test/SILOptimizer/predictable_memopt_ownership.sil
./test/SILOptimizer/devirt_static_witness_method.sil
./test/SILOptimizer/devirt_opaque_witness.swift
./test/SILOptimizer/no_size_specialization.swift
./test/SILOptimizer/ome_strip_deserialize.sil
./test/SILOptimizer/stop_after_module.swift
./test/SILOptimizer/specialize_ext.swift
./test/SILOptimizer/devirt_speculative_init.swift
./test/SILOptimizer/let_properties_opts.swift
./test/SILOptimizer/simplify_cfg_and_combine.sil
./test/SILOptimizer/funcsig_explode_heuristic_inline.sil
./test/SILOptimizer/closure_lifetime_fixup_objc.swift
./test/SILOptimizer/capture_promotion_ownership.sil
./test/SILOptimizer/diagnostic_constant_propagation_int_arch64.swift
./test/SILOptimizer/lslocation_expansion.sil
./test/SILOptimizer/diagnose_unreachable.swift
./test/SILOptimizer/sil_combine_same_ops.sil
./test/SILOptimizer/opaque_values_opt.sil
./test/SILOptimizer/early-rle.sil
./test/SILOptimizer/constant_propagation_ownership.sil
./test/SILOptimizer/constant_evaluator_skip_test.sil
./test/SILOptimizer/di-loadable-by-addr-scope.swift
./test/SILOptimizer/OSLogMandatoryOptTest.swift
./test/SILOptimizer/specialize_ossa.sil
./test/SILOptimizer/mandatory_inlining.sil
./test/SILOptimizer/copyforward.sil
./test/SILOptimizer/inlinealways_inliner.sil
./test/SILOptimizer/definite_init_markuninitialized_delegatingself.sil
./test/SILOptimizer/specialize_class_inherits_base_inherits_protocol.swift
./test/SILOptimizer/devirt_conditional_conformance.swift
./test/SILOptimizer/access_marker_elim.sil
./test/SILOptimizer/devirt_extension.swift
./test/SILOptimizer/prespecialize.swift
./test/SILOptimizer/devirtualize_protocol_composition_two_stores.sil
./test/SILOptimizer/exclusivity_static_diagnostics_objc.swift
./test/SILOptimizer/simplify_cfg_opaque.sil
./test/SILOptimizer/sil_combine_uncheck.sil
./test/SILOptimizer/inline_tryApply.sil
./test/SILOptimizer/devirt_covariant_return.swift
./test/SILOptimizer/closure_specialize_opaque.sil
./test/SILOptimizer/mandatory_inlining.swift
./test/SILOptimizer/redundant_phi_elimination.sil
./test/SILOptimizer/specialize_anyobject.swift
./test/SILOptimizer/raw_sil_inst_lowering.sil
./test/SILOptimizer/devirt_dependent_types.swift
./test/SILOptimizer/global_init_opt.swift
./test/SILOptimizer/dead_function_elimination.swift
./test/SILOptimizer/devirt_speculative_nested.swift
./test/SILOptimizer/devirt_access_serialized_ownership.sil
./test/SILOptimizer/cast_folding_objc.swift
./test/SILOptimizer/inline_caches.sil
./test/SILOptimizer/specialize_inherited_multifile.swift
./test/SILOptimizer/existential_transform.swift
./test/SILOptimizer/devirt_outer_requirements.swift
./test/SILOptimizer/static_arrays.swift
./test/SILOptimizer/definite_init_objc_factory_init.swift
./test/SILOptimizer/definite_init_failable_initializers_diagnostics.swift
./test/SILOptimizer/simplify_cfg_unique_values.sil
./test/SILOptimizer/address_projection.sil
./test/SILOptimizer/sil_combine1.swift
./test/SILOptimizer/simp_enum.sil
./test/SILOptimizer/accessed_storage_analysis.sil
./test/SILOptimizer/dead_witness_module.swift
./test/SILOptimizer/definite_init_value_types_diagnostics.swift
./test/SILOptimizer/unsafe_guaranteed_peephole.sil
./test/SILOptimizer/specialize_deep_generics.swift
./test/SILOptimizer/always_inline.sil
./test/SILOptimizer/specialize_cg_update_crash.sil
./test/SILOptimizer/mandatory_inlining_ownership.sil
./test/SILOptimizer/devirt_alloc_ref_dynamic.sil
./test/SILOptimizer/definite_init_nsmanagedvalue.swift
./test/SILOptimizer/allocstack_hoisting.sil
./test/SILOptimizer/sil_combine_protocol_conf.swift
./test/SILOptimizer/devirt_unbound_generic.swift
./test/SILOptimizer/capture_promotion.swift
./test/SILOptimizer/simplify_cfg_simple.sil
./test/SILOptimizer/arcsequenceopts.sil
./test/SILOptimizer/mem2reg_simple.sil
./test/SILOptimizer/semantic-arc-opts-canonical.sil
./test/SILOptimizer/devirtualize2.sil
./test/SILOptimizer/canonicalize_switch_enum.sil
./test/SILOptimizer/sroa_bbargs.sil
./test/SILOptimizer/mandatory_inlining_devirt_multifile.swift
./test/SILOptimizer/inlinecaches_invalidate_failure.sil
./test/SILOptimizer/allocbox_to_stack_ownership.sil
./test/SILOptimizer/generalized_accessors.swift
./test/SILOptimizer/licm_multiend.sil
./test/SILOptimizer/pointer_conversion_objc.swift
./test/SILOptimizer/constant_propagation_floats.sil
./test/SILOptimizer/functionsigopts_string_public.swift
./test/SILOptimizer/compare_types.swift
./test/SILOptimizer/move_cond_fail_simplify_cfg.sil
./test/SILOptimizer/closure_specialize_and_cfg.sil
./test/SILOptimizer/address_lowering.sil
./test/SILOptimizer/dead_store_elim.sil
./test/SILOptimizer/redundant_load_and_dead_store_elim.sil
./test/SILOptimizer/definite_init_diagnostics.swift
./test/SILOptimizer/licm_exclusivity.sil
./test/SILOptimizer/escape_analysis_invalidate.sil
./test/SILOptimizer/property_wrappers_and_tuples.swift
./test/SILOptimizer/mandatory_inlining_circular.sil
./test/SILOptimizer/OSLogCompilerDiagnosticsTest.swift
./test/SILOptimizer/constant_evaluable_subset_test.swift
./test/SILOptimizer/static_report.sil
./test/SILOptimizer/specialize_default_witness.sil
./test/SILOptimizer/closure-lifetime-fixup.sil
./test/SILOptimizer/mem2reg.sil
./test/SILOptimizer/pound_assert_ossa.sil
./test/SILOptimizer/inline_self.swift
./test/SILOptimizer/simplify_switch_enum_objc.swift
./test/SILOptimizer/specialize_self_conforming.swift
./test/SILOptimizer/specialize_opaque_result_types.sil
./test/SILOptimizer/ownership_model_eliminator_resilience.sil
./test/SILOptimizer/string_literals.swift
./test/SILOptimizer/invalid_escaping_captures.swift
./test/SILOptimizer/pound_assert_removed.swift
./test/SILOptimizer/devirt_default_witness_method_ownership.sil
./test/SILOptimizer/spec_recursion.swift
./test/SILOptimizer/cropoverflow.sil
./test/SILOptimizer/bug-reducer-tester-opt-crasher.sil
./test/SILOptimizer/verifier.sil
./test/SILOptimizer/pound_assert_test_recursive.swift
./test/SILOptimizer/array_specialize.sil
./test/SILOptimizer/access_wmo.swift
./test/SILOptimizer/lslocation_reduction.sil
./test/SILOptimizer/access_enforcement_options.swift
./test/SILOptimizer/merge_exclusivity.swift
./test/SILOptimizer/Inputs
./test/SILOptimizer/Inputs/bug-reducer-tester-miscompile-driver.swift
./test/SILOptimizer/Inputs/mandatory_inlining_devirt_other.swift
./test/SILOptimizer/Inputs/specialize_opaque_type_archetypes_multifile_A.swift
./test/SILOptimizer/Inputs/usr
./test/SILOptimizer/Inputs/usr/include
./test/SILOptimizer/Inputs/usr/include/closure_lifetime_fixup_objc.h
./test/SILOptimizer/Inputs/usr/include/module.map
./test/SILOptimizer/Inputs/Outliner.h
./test/SILOptimizer/Inputs/dse_with_union.h
./test/SILOptimizer/Inputs/optional_closure_bridging.h
./test/SILOptimizer/Inputs/keypaths_objc.h
./test/SILOptimizer/Inputs/CXXTypesWithUserProvidedDestructor.h
./test/SILOptimizer/Inputs/opaque_conformance.swift
./test/SILOptimizer/Inputs/include
./test/SILOptimizer/Inputs/include/Gizmo.h
./test/SILOptimizer/Inputs/include/module.map
./test/SILOptimizer/Inputs/devirt_access_helper.swift
./test/SILOptimizer/Inputs/cross-submodule.swift
./test/SILOptimizer/Inputs/capture_propagation_linkage
./test/SILOptimizer/Inputs/capture_propagation_linkage/main.swift
./test/SILOptimizer/Inputs/access_marker_verify_objc.h
./test/SILOptimizer/Inputs/switch_enum_objc.h
./test/SILOptimizer/Inputs/abi
./test/SILOptimizer/Inputs/abi/module.map
./test/SILOptimizer/Inputs/abi/c_layout.h
./test/SILOptimizer/Inputs/ome_strip_deserialize_input.sil
./test/SILOptimizer/Inputs/type_lowering_resilience_other.swift
./test/SILOptimizer/Inputs/extension-with-nested-type.swift
./test/SILOptimizer/Inputs/licm_and_global_addr
./test/SILOptimizer/Inputs/licm_and_global_addr/test.swift
./test/SILOptimizer/Inputs/licm_and_global_addr/main.swift
./test/SILOptimizer/Inputs/devirt_access_other_module.swift
./test/SILOptimizer/Inputs/cross-module.swift
./test/SILOptimizer/Inputs/specialize_opaque_type_archetypes_3.swift
./test/SILOptimizer/Inputs/cse_metatype_conformanceC.swift
./test/SILOptimizer/Inputs/di_property_wrappers_errors_multifile_2.swift
./test/SILOptimizer/Inputs/sil_witness_tables_external_input.swift
./test/SILOptimizer/Inputs/access_wmo_def.swift
./test/SILOptimizer/Inputs/TestModule.swift
./test/SILOptimizer/Inputs/cse_metatype_conformanceA.swift
./test/SILOptimizer/Inputs/TestMod.sil
./test/SILOptimizer/Inputs/Closure.h
./test/SILOptimizer/Inputs/opaque_result_types.swift
./test/SILOptimizer/Inputs/Problems.swift
./test/SILOptimizer/Inputs/BaseProblem.swift
./test/SILOptimizer/Inputs/module.modulemap
./test/SILOptimizer/Inputs/specialize_opaque_type_archetypes_4.swift
./test/SILOptimizer/Inputs/specialize_inherited_multifile.swift
./test/SILOptimizer/Inputs/public_class.swift
./test/SILOptimizer/Inputs/definite_init_cross_module
./test/SILOptimizer/Inputs/definite_init_cross_module/BridgingHeader.h
./test/SILOptimizer/Inputs/definite_init_cross_module/OtherModule.swift
./test/SILOptimizer/Inputs/linker_pass_input.swift
./test/SILOptimizer/Inputs/cross-module-objc.swift
./test/SILOptimizer/Inputs/objc_optional.h
./test/SILOptimizer/Inputs/cse_metatype_conformanceB.swift
./test/SILOptimizer/Inputs/specialize_opaque_type_archetypes_2.swift
./test/SILOptimizer/Inputs/internal_func.swift
./test/SILOptimizer/simplify_cfg_select_enum.sil
./test/SILOptimizer/performance_inliner_ownership.sil
./test/SILOptimizer/retain_release_code_motion.sil
./test/SILOptimizer/basic-callee-printer.sil
./test/SILOptimizer/sil_locations.sil
./test/SILOptimizer/epilogue_arc_dumper.sil
./test/SILOptimizer/licm_apply.sil
./test/SILOptimizer/definite_init_type_of_self_in_convenience_init.swift
./test/SILOptimizer/OSLogFullOptTest.swift
./test/SILOptimizer/predictable_memopt.sil
./test/SILOptimizer/devirt_archetype_method.swift
./test/SILOptimizer/predictable_deadalloc_elim_ownership.sil
./test/SILOptimizer/definite_init_hang.swift
./test/SILOptimizer/inlinecaches_arc.sil
./test/SILOptimizer/cast_folding_objc_no_foundation.swift
./test/SILOptimizer/inout_deshadow_integration.swift
./test/SILOptimizer/let_properties_opts_non_trivial.sil
./test/SILOptimizer/mandatory_inlining_ossa_to_non_ossa.sil
./test/SILOptimizer/devirt_ctors.sil
./test/SILOptimizer/switch_enum_objc.swift
./test/SILOptimizer/stack-nesting-wrong-scope.swift
./test/SILOptimizer/closure_specialize_simple.sil
./test/Unit
./test/Unit/lit.cfg
./test/Unit/lit.site.cfg.in
./test/Sanitizers
./test/Sanitizers/tsan-libdispatch.swift
./test/Sanitizers/tsan-norace-deinit-run-time.swift
./test/Sanitizers/sanitizer_coverage.swift
./test/Sanitizers/tsan-emptyarraystorage.swift
./test/Sanitizers/asan.swift
./test/Sanitizers/tsan.swift
./test/Sanitizers/asan_interface.h
./test/Sanitizers/scudo.swift
./test/Sanitizers/tsan-norace-block-release.swift
./test/Sanitizers/asan-globals-overwrite.swift
./test/Sanitizers/lit.local.cfg
./test/Sanitizers/asan_recover.swift
./test/Sanitizers/tsan-static-exclusivity.swift
./test/CMakeLists.txt
./test/ClangImporter
./test/ClangImporter/objc_ir.swift
./test/ClangImporter/objc_bridging.swift
./test/ClangImporter/protocol-conformance-in-extension.swift
./test/ClangImporter/objc_diags.swift
./test/ClangImporter/objc_ibaction.swift
./test/ClangImporter/submodules_indirect.swift
./test/ClangImporter/objc_generics_conformance.swift
./test/ClangImporter/generic_compatibility_alias.swift
./test/ClangImporter/system-framework-search-path.swift
./test/ClangImporter/const_and_pure.swift
./test/ClangImporter/availability_macosx.swift
./test/ClangImporter/enum-anon-sized.swift
./test/ClangImporter/windows-sdk-macros.swift
./test/ClangImporter/pch-bridging-header-unittest-ok.swift
./test/ClangImporter/enum-anon.swift
./test/ClangImporter/objc_bridging_generics.swift
./test/ClangImporter/availability_returns_twice-msvc.swift
./test/ClangImporter/serialization-sil.swift
./test/ClangImporter/nullability.swift
./test/ClangImporter/unserializable-clang-function-types.swift
./test/ClangImporter/objc_parse_verifier.swift
./test/ClangImporter/objc_dynamic_lookup.swift
./test/ClangImporter/pcm-emit-and-import.swift
./test/ClangImporter/objc_init_redundant.swift
./test/ClangImporter/attr-swift_name_renaming.swift
./test/ClangImporter/private_frameworks_autolink2.swift
./test/ClangImporter/swift2_warnings.swift
./test/ClangImporter/remarks.swift
./test/ClangImporter/ctypes_parse_objc.swift
./test/ClangImporter/pch-bridging-header-unittest-warn.swift
./test/ClangImporter/diags-with-many-imports.swift
./test/ClangImporter/objc_factory_method.swift
./test/ClangImporter/sdk-bridging-header.swift
./test/ClangImporter/Darwin_sdk_test.swift
./test/ClangImporter/import-as-member.swift
./test/ClangImporter/static_inline_serialize.swift
./test/ClangImporter/objc_bridging_custom.swift
./test/ClangImporter/clang_builtins.swift
./test/ClangImporter/protocol-member-renaming.swift
./test/ClangImporter/private_frameworks_autolink.swift
./test/ClangImporter/availability_variadic.swift
./test/ClangImporter/enum-cxx.swift
./test/ClangImporter/enum-error-execute.swift
./test/ClangImporter/custom-include.swift
./test/ClangImporter/foreign_errors.swift
./test/ClangImporter/c_inside_objc.swift
./test/ClangImporter/cxx_interop.swift
./test/ClangImporter/accessibility_framework.swift
./test/ClangImporter/enum-with-target.swift
./test/ClangImporter/inlinable_bitfields.swift
./test/ClangImporter/SceneKit_test.swift
./test/ClangImporter/sdk.swift
./test/ClangImporter/ctypes_parse_union.swift
./test/ClangImporter/static_inline.swift
./test/ClangImporter/enum-exhaustivity.swift
./test/ClangImporter/cvars_ir.swift
./test/ClangImporter/pch-bridging-header-serialized-diagnostics.swift
./test/ClangImporter/broken-modules.swift
./test/ClangImporter/cstring_parse.swift
./test/ClangImporter/attr-objc_subclassing_restricted.swift
./test/ClangImporter/cf.swift
./test/ClangImporter/objc_class_subscript.swift
./test/ClangImporter/mirror_instance_property_static_method.swift
./test/ClangImporter/availability_watchos.swift
./test/ClangImporter/objc_init_conformance.swift
./test/ClangImporter/CoreServices_test.swift
./test/ClangImporter/inherited-protocols-sil.swift
./test/ClangImporter/pch-bridging-header-module-map-diags.swift
./test/ClangImporter/objc_init.swift
./test/ClangImporter/indirect_field_codegen.swift
./test/ClangImporter/enum-error-case-alias.swift
./test/ClangImporter/enum-inferred-exhaustivity.swift
./test/ClangImporter/submodules-bridging-header.swift
./test/ClangImporter/bad-deployment-target.swift
./test/ClangImporter/enum-objc.swift
./test/ClangImporter/availability.swift
./test/ClangImporter/restated-protocol-requirement.swift
./test/ClangImporter/simd.swift
./test/ClangImporter/availability_app_extension.swift
./test/ClangImporter/long-long-promotion.swift
./test/ClangImporter/AppKit_test.swift
./test/ClangImporter/objc_subscript.swift
./test/ClangImporter/disable-source-import.swift
./test/ClangImporter/cfuncs_parse.swift
./test/ClangImporter/objc_protocol_renaming.swift
./test/ClangImporter/subclass_existentials.swift
./test/ClangImporter/availability_open_enums.swift
./test/ClangImporter/serialization-search-paths.swift
./test/ClangImporter/clang-function-types.swift
./test/ClangImporter/ctypes_parse_macosx.swift
./test/ClangImporter/predefined_macros.swift
./test/ClangImporter/submodules_scoped.swift
./test/ClangImporter/objc_mismatched_names.swift
./test/ClangImporter/no-sdk.swift
./test/ClangImporter/cfuncs_ir.swift
./test/ClangImporter/invalid_bridging_header.swift
./test/ClangImporter/no-fake-source-buffer-excerpts.swift
./test/ClangImporter/objc_redeclared_properties_incompatible.swift
./test/ClangImporter/objc_init_generics.swift
./test/ClangImporter/objc_id_as_any.swift
./test/ClangImporter/submodules.swift
./test/ClangImporter/objc_init_override_kind.swift
./test/ClangImporter/Darwin_test.swift
./test/ClangImporter/protocol_metatype_object_conversion.swift
./test/ClangImporter/cfuncs_scope.swift
./test/ClangImporter/private_frameworks.swift
./test/ClangImporter/objc_proxies.swift
./test/ClangImporter/overlay_with_submodule.swift
./test/ClangImporter/autolinking.swift
./test/ClangImporter/indirect_fields.swift
./test/ClangImporter/no-nsobject-protocol.swift
./test/ClangImporter/bad-ns-extensible-string-enum.swift
./test/ClangImporter/availability_platform_categories.swift
./test/ClangImporter/objc_direct.swift
./test/ClangImporter/nested_protocol_name.swift
./test/ClangImporter/diags_from_header.swift
./test/ClangImporter/objc_nsmanagedobject.swift
./test/ClangImporter/CoreMIDI_test.swift
./test/ClangImporter/pch-bridging-header-vs-modular-interface-defn.swift
./test/ClangImporter/missing-overlay.swift
./test/ClangImporter/non-modular-include.swift
./test/ClangImporter/script.swift
./test/ClangImporter/import-as-member-objc.swift
./test/ClangImporter/Security_test.swift
./test/ClangImporter/MixedSource
./test/ClangImporter/MixedSource/forward-declarations.swift
./test/ClangImporter/MixedSource/submodule.swift
./test/ClangImporter/MixedSource/Xcc_include.swift
./test/ClangImporter/MixedSource/resolve-cross-language.swift
./test/ClangImporter/MixedSource/import-as-member-swift.swift
./test/ClangImporter/MixedSource/broken-bridging-header.swift
./test/ClangImporter/MixedSource/broken-modules.swift
./test/ClangImporter/MixedSource/mixed-target-using-header.swift
./test/ClangImporter/MixedSource/autolinking.swift
./test/ClangImporter/MixedSource/mixed-nsuinteger.swift
./test/ClangImporter/MixedSource/import-mixed-with-header-twice.swift
./test/ClangImporter/MixedSource/can_import_objc_idempotent.swift
./test/ClangImporter/MixedSource/defer-supermodule-import.swift
./test/ClangImporter/MixedSource/mixed-target-using-module.swift
./test/ClangImporter/MixedSource/mixed-target-using-header-swift4.swift
./test/ClangImporter/MixedSource/import-mixed-framework.swift
./test/ClangImporter/MixedSource/import-mixed-framework-with-forward.swift
./test/ClangImporter/MixedSource/Inputs
./test/ClangImporter/MixedSource/Inputs/broken-modules
./test/ClangImporter/MixedSource/Inputs/broken-modules/MissingDependencyFromSwift.swift
./test/ClangImporter/MixedSource/Inputs/broken-modules/BrokenClangModule.h
./test/ClangImporter/MixedSource/Inputs/broken-modules/MissingDependencyFromClang.h
./test/ClangImporter/MixedSource/Inputs/broken-modules/module.modulemap
./test/ClangImporter/MixedSource/Inputs/import-as-member-swift.h
./test/ClangImporter/MixedSource/Inputs/submodule
./test/ClangImporter/MixedSource/Inputs/submodule/Submodule.h
./test/ClangImporter/MixedSource/Inputs/submodule/Mixed.h
./test/ClangImporter/MixedSource/Inputs/submodule/module.modulemap
./test/ClangImporter/MixedSource/Inputs/import-mixed-framework-with-forward.h
./test/ClangImporter/MixedSource/Inputs/mixed-target
./test/ClangImporter/MixedSource/Inputs/mixed-target/Mixed.framework
./test/ClangImporter/MixedSource/Inputs/mixed-target/Mixed.framework/Mixed
./test/ClangImporter/MixedSource/Inputs/mixed-target/Mixed.framework/module.map
./test/ClangImporter/MixedSource/Inputs/mixed-target/Mixed.framework/Headers
./test/ClangImporter/MixedSource/Inputs/mixed-target/Mixed.framework/Headers/Mixed.h
./test/ClangImporter/MixedSource/Inputs/mixed-target/header.h
./test/ClangImporter/MixedSource/Inputs/mixed-target/used-by-both-headers.h
./test/ClangImporter/MixedSource/Inputs/mixed-target/other-file.swift
./test/ClangImporter/MixedSource/Inputs/mixed-target/header-again.h
./test/ClangImporter/MixedSource/Inputs/AutolinkingTest.framework
./test/ClangImporter/MixedSource/Inputs/AutolinkingTest.framework/AutolinkingTest
./test/ClangImporter/MixedSource/Inputs/AutolinkingTest.framework/Headers
./test/ClangImporter/MixedSource/Inputs/AutolinkingTest.framework/Headers/AutolinkingTest.h
./test/ClangImporter/MixedSource/Inputs/AutolinkingTest.framework/Modules
./test/ClangImporter/MixedSource/Inputs/AutolinkingTest.framework/Modules/module.modulemap
./test/ClangImporter/MixedSource/Inputs/error-on-define-impl.h
./test/ClangImporter/MixedSource/Inputs/resolve-cross-language
./test/ClangImporter/MixedSource/Inputs/resolve-cross-language/Base.swift
./test/ClangImporter/MixedSource/Inputs/resolve-cross-language/BaseUser.framework
./test/ClangImporter/MixedSource/Inputs/resolve-cross-language/BaseUser.framework/module.map
./test/ClangImporter/MixedSource/Inputs/resolve-cross-language/BaseUser.framework/Headers
./test/ClangImporter/MixedSource/Inputs/resolve-cross-language/BaseUser.framework/Headers/BaseUser.h
./test/ClangImporter/MixedSource/Inputs/resolve-cross-language/Base-module.map
./test/ClangImporter/MixedSource/Inputs/mixed-with-header-again.swift
./test/ClangImporter/MixedSource/Inputs/user-module
./test/ClangImporter/MixedSource/Inputs/user-module/module.map
./test/ClangImporter/MixedSource/Inputs/user-module/user.h
./test/ClangImporter/MixedSource/Inputs/mixed-framework
./test/ClangImporter/MixedSource/Inputs/mixed-framework/Mixed.framework
./test/ClangImporter/MixedSource/Inputs/mixed-framework/Mixed.framework/module.map
./test/ClangImporter/MixedSource/Inputs/mixed-framework/Mixed.framework/Headers
./test/ClangImporter/MixedSource/Inputs/mixed-framework/Mixed.framework/Headers/Mixed.h
./test/ClangImporter/MixedSource/Inputs/mixed-framework/Mixed.framework/Modules
./test/ClangImporter/MixedSource/Inputs/mixed-framework/Mixed.framework/Modules/Mixed.swiftmodule
./test/ClangImporter/MixedSource/Inputs/mixed-framework/Mixed.framework/Modules/Mixed.swiftmodule/.keep
./test/ClangImporter/MixedSource/Inputs/mixed-framework/Mixed.swift
./test/ClangImporter/MixedSource/Inputs/mixed-with-header.swift
./test/ClangImporter/MixedSource/Inputs/forward-declarations.h
./test/ClangImporter/MixedSource/Inputs/error-on-define.h
./test/ClangImporter/MixedSource/Inputs/forward-declarations-other.swift
./test/ClangImporter/MixedSource/Inputs/defer-supermodule-import
./test/ClangImporter/MixedSource/Inputs/defer-supermodule-import/Some-Bridging-Header.h
./test/ClangImporter/MixedSource/Inputs/defer-supermodule-import/Some.framework
./test/ClangImporter/MixedSource/Inputs/defer-supermodule-import/Some.framework/Headers
./test/ClangImporter/MixedSource/Inputs/defer-supermodule-import/Some.framework/Headers/Some.h
./test/ClangImporter/MixedSource/Inputs/defer-supermodule-import/Some.framework/Headers/Submodule.h
./test/ClangImporter/MixedSource/Inputs/defer-supermodule-import/Some.framework/Modules
./test/ClangImporter/MixedSource/Inputs/defer-supermodule-import/Some.framework/Modules/module.modulemap
./test/ClangImporter/MixedSource/Inputs/Xcc_include.h
./test/ClangImporter/MixedSource/import-mixed-with-header.swift
./test/ClangImporter/objc_failable_inits.swift
./test/ClangImporter/newtype_conformance.swift
./test/ClangImporter/sdk-protocol-class.swift
./test/ClangImporter/pch-bridging-header-with-another-bridging-header.swift
./test/ClangImporter/CoreGraphics_test.swift
./test/ClangImporter/typedef_with_generic_param.swift
./test/ClangImporter/ctypes_parse_swift4.swift
./test/ClangImporter/overlay.swift
./test/ClangImporter/attr-swift_name_renaming-objc.swift
./test/ClangImporter/ctypes_parse.swift
./test/ClangImporter/ctypes_parse_bitfields.swift
./test/ClangImporter/attr-swift_private.swift
./test/ClangImporter/cvars_parse.swift
./test/ClangImporter/diags_from_module.swift
./test/ClangImporter/private_frameworks_modules.swift
./test/ClangImporter/attr-swift_name.swift
./test/ClangImporter/objc_missing_designated_init.swift
./test/ClangImporter/objc-cross-module-override.swift
./test/ClangImporter/blocks_returning_bool.swift
./test/ClangImporter/import-as-member-versioned.swift
./test/ClangImporter/subclass_existentials_ir.swift
./test/ClangImporter/objc_redeclared_properties_categories.swift
./test/ClangImporter/objc_final_dynamic.swift
./test/ClangImporter/working-directory.swift
./test/ClangImporter/objc_redeclared_properties.swift
./test/ClangImporter/enum-new.swift
./test/ClangImporter/objc_curried_method.swift
./test/ClangImporter/blocks_parse.swift
./test/ClangImporter/objc_implicit_with.swift
./test/ClangImporter/availability_returns_twice.swift
./test/ClangImporter/requires.swift
./test/ClangImporter/macros_redef.swift
./test/ClangImporter/enum-dataflow.swift
./test/ClangImporter/pch-bridging-header-deps-fine.swift
./test/ClangImporter/can_import_missing_requirement.swift
./test/ClangImporter/pch-loading-error.swift
./test/ClangImporter/nullability_silgen.swift
./test/ClangImporter/optional.swift
./test/ClangImporter/swift_modules.swift
./test/ClangImporter/pch-bridging-header.swift
./test/ClangImporter/objc_parse.swift
./test/ClangImporter/enum-exhaustivity-system.swift
./test/ClangImporter/ctypes_ir.swift
./test/ClangImporter/cxx_interop_ir.swift
./test/ClangImporter/objc_runtime_visible.swift
./test/ClangImporter/diags-from-many-modules.swift
./test/ClangImporter/macros.swift
./test/ClangImporter/objc_forward_declarations.swift
./test/ClangImporter/enum.swift
./test/ClangImporter/objc_override.swift
./test/ClangImporter/objc_bridge_categories.swift
./test/ClangImporter/uikit_hacks.swift
./test/ClangImporter/Dispatch_test.swift
./test/ClangImporter/mirror_import_overrides.swift
./test/ClangImporter/clang_builtin_pcm.swift
./test/ClangImporter/enum-error.swift
./test/ClangImporter/mapped-integers.swift.gyb
./test/ClangImporter/Inputs
./test/ClangImporter/Inputs/app-bridging-header-to-pch.h
./test/ClangImporter/Inputs/ImportAsMemberSwiftVersioned_a.swift
./test/ClangImporter/Inputs/static_inline.h
./test/ClangImporter/Inputs/macros_redef.h
./test/ClangImporter/Inputs/no-import-objc
./test/ClangImporter/Inputs/no-import-objc/module.map
./test/ClangImporter/Inputs/no-import-objc/people.h
./test/ClangImporter/Inputs/invalid_bridging_header.h
./test/ClangImporter/Inputs/missing-requirement
./test/ClangImporter/Inputs/missing-requirement/module.modulemap
./test/ClangImporter/Inputs/enum-objc.h
./test/ClangImporter/Inputs/ModuleMapWarning
./test/ClangImporter/Inputs/ModuleMapWarning/PrivateWarning.framework
./test/ClangImporter/Inputs/ModuleMapWarning/PrivateWarning.framework/PrivateHeaders
./test/ClangImporter/Inputs/ModuleMapWarning/PrivateWarning.framework/PrivateHeaders/PrivateWarning_Private.h
./test/ClangImporter/Inputs/ModuleMapWarning/PrivateWarning.framework/Headers
./test/ClangImporter/Inputs/ModuleMapWarning/PrivateWarning.framework/Headers/PrivateWarning.h
./test/ClangImporter/Inputs/ModuleMapWarning/PrivateWarning.framework/Modules
./test/ClangImporter/Inputs/ModuleMapWarning/PrivateWarning.framework/Modules/module.private.modulemap
./test/ClangImporter/Inputs/ModuleMapWarning/PrivateWarning.framework/Modules/module.modulemap
./test/ClangImporter/Inputs/ModuleMapWarning/bridging-pch.h
./test/ClangImporter/Inputs/enum-error.m
./test/ClangImporter/Inputs/bad-ns-extensible-string-enum.h
./test/ClangImporter/Inputs/restated-protocol-requirement.h
./test/ClangImporter/Inputs/ImplementProtoRenaming.swift
./test/ClangImporter/Inputs/mirror_import_overrides_1.h
./test/ClangImporter/Inputs/enum-anon.h
./test/ClangImporter/Inputs/inlinable_bitfields_other.swift
./test/ClangImporter/Inputs/objc_curried_method.h
./test/ClangImporter/Inputs/ImportAsMemberSwiftVersioned_b.swift
./test/ClangImporter/Inputs/attr-objc_subclassing_restricted.h
./test/ClangImporter/Inputs/no-fake-source-buffer-excerpts.h
./test/ClangImporter/Inputs/non-modular
./test/ClangImporter/Inputs/non-modular/NonModular.h
./test/ClangImporter/Inputs/non-modular/Foo.framework
./test/ClangImporter/Inputs/non-modular/Foo.framework/Headers
./test/ClangImporter/Inputs/non-modular/Foo.framework/Headers/Foo.h
./test/ClangImporter/Inputs/non-modular/Foo.framework/Modules
./test/ClangImporter/Inputs/non-modular/Foo.framework/Modules/module.modulemap
./test/ClangImporter/Inputs/overlay_extension_initializer.swift
./test/ClangImporter/Inputs/nested_protocol_name.h
./test/ClangImporter/Inputs/static_inline.swift
./test/ClangImporter/Inputs/bad-bridging-header.h
./test/ClangImporter/Inputs/app-that-uses-pch-bridging-header.swift
./test/ClangImporter/Inputs/chained-unit-test-bridging-header-to-pch.h
./test/ClangImporter/Inputs/objc_direct.h
./test/ClangImporter/Inputs/availability_platform_categories.h
./test/ClangImporter/Inputs/enum-inferred-exhaustivity.h
./test/ClangImporter/Inputs/SerializationHelper.swift
./test/ClangImporter/Inputs/mirror_import_overrides_2.h
./test/ClangImporter/Inputs/pch-bridging-header-with-another-bridging-header
./test/ClangImporter/Inputs/pch-bridging-header-with-another-bridging-header/unit-tests.h
./test/ClangImporter/Inputs/pch-bridging-header-with-another-bridging-header/app.h
./test/ClangImporter/Inputs/pch-bridging-header-with-another-bridging-header/has_warning.h
./test/ClangImporter/Inputs/objc_init_override_kind.h
./test/ClangImporter/Inputs/protocol-member-renaming.h
./test/ClangImporter/Inputs/System
./test/ClangImporter/Inputs/System/Library
./test/ClangImporter/Inputs/System/Library/Frameworks
./test/ClangImporter/Inputs/System/Library/Frameworks/LinkFramework.framework
./test/ClangImporter/Inputs/System/Library/Frameworks/LinkFramework.framework/LinkFramework
./test/ClangImporter/Inputs/System/Library/Frameworks/LinkFramework.framework/module.map
./test/ClangImporter/Inputs/System/Library/Frameworks/LinkFramework.framework/Headers
./test/ClangImporter/Inputs/System/Library/Frameworks/LinkFramework.framework/Headers/LinkFramework.h
./test/ClangImporter/Inputs/pch-bridging-header-with-non-modular-import.h
./test/ClangImporter/Inputs/sdk-bridging-header.h
./test/ClangImporter/Inputs/typedef-with-generic-param.h
./test/ClangImporter/Inputs/SwiftPrivateAttr.txt
./test/ClangImporter/Inputs/const_and_pure.h
./test/ClangImporter/Inputs/sdk-protocol-class
./test/ClangImporter/Inputs/sdk-protocol-class/os3.swift
./test/ClangImporter/Inputs/sdk-protocol-class/os1.swift
./test/ClangImporter/Inputs/sdk-protocol-class/os2.swift
./test/ClangImporter/Inputs/many-imports
./test/ClangImporter/Inputs/many-imports/obsoleted.h
./test/ClangImporter/Inputs/many-imports/module.modulemap
./test/ClangImporter/Inputs/diags_from_header.h
./test/ClangImporter/Inputs/MoreSwiftNewtypes_tests.swift
./test/ClangImporter/Inputs/systemframeworks
./test/ClangImporter/Inputs/systemframeworks/Module.framework
./test/ClangImporter/Inputs/systemframeworks/Module.framework/Headers
./test/ClangImporter/Inputs/systemframeworks/Module.framework/Headers/Module.h
./test/ClangImporter/Inputs/systemframeworks/Module.framework/Modules
./test/ClangImporter/Inputs/systemframeworks/Module.framework/Modules/module.modulemap
./test/ClangImporter/Inputs/enum-error.h
./test/ClangImporter/Inputs/overlay.swift
./test/ClangImporter/Inputs/custom-modules
./test/ClangImporter/Inputs/custom-modules/MacrosDeliberateRedefB
./test/ClangImporter/Inputs/custom-modules/MacrosDeliberateRedefB/Newer.h
./test/ClangImporter/Inputs/custom-modules/MacrosDeliberateRedefB/module.modulemap
./test/ClangImporter/Inputs/custom-modules/ObjCParseExtras.h
./test/ClangImporter/Inputs/custom-modules/Warnings1.h
./test/ClangImporter/Inputs/custom-modules/Warnings5.h
./test/ClangImporter/Inputs/custom-modules/ForwardDeclarationsHelper.h
./test/ClangImporter/Inputs/custom-modules/ObjCParseExtrasToo.h
./test/ClangImporter/Inputs/custom-modules/SubclassExistentialsExtra.h
./test/ClangImporter/Inputs/custom-modules/MoreSwiftNewtypes.h
./test/ClangImporter/Inputs/custom-modules/Protocols.h
./test/ClangImporter/Inputs/custom-modules/ObjCParseExtrasInitHelper.h
./test/ClangImporter/Inputs/custom-modules/script.h
./test/ClangImporter/Inputs/custom-modules/ImportsMissingHeader.h
./test/ClangImporter/Inputs/custom-modules/ObjCBridgeNonconforming.h
./test/ClangImporter/Inputs/custom-modules/SwiftName.h
./test/ClangImporter/Inputs/custom-modules/UsesSubmodule.h
./test/ClangImporter/Inputs/custom-modules/Warnings8.h
./test/ClangImporter/Inputs/custom-modules/Warnings2.h
./test/ClangImporter/Inputs/custom-modules/NewtypeSystem.h
./test/ClangImporter/Inputs/custom-modules/Warnings6.h
./test/ClangImporter/Inputs/custom-modules/ObjCParseExtrasSystem.h
./test/ClangImporter/Inputs/custom-modules/Submodule.h
./test/ClangImporter/Inputs/custom-modules/AliasCaseErrorEnum
./test/ClangImporter/Inputs/custom-modules/AliasCaseErrorEnum/AliasCaseErrorEnum.apinotes
./test/ClangImporter/Inputs/custom-modules/AliasCaseErrorEnum/module.map
./test/ClangImporter/Inputs/custom-modules/AliasCaseErrorEnum/AliasCaseErrorEnum.h
./test/ClangImporter/Inputs/custom-modules/ConditionallyFoo.h
./test/ClangImporter/Inputs/custom-modules/SwiftName.apinotes
./test/ClangImporter/Inputs/custom-modules/MacrosRedefWithParallelSubmodules
./test/ClangImporter/Inputs/custom-modules/MacrosRedefWithParallelSubmodules/A.h
./test/ClangImporter/Inputs/custom-modules/MacrosRedefWithParallelSubmodules/B.h
./test/ClangImporter/Inputs/custom-modules/MacrosRedefWithParallelSubmodules/module.modulemap
./test/ClangImporter/Inputs/custom-modules/LocalVsFileScope.h
./test/ClangImporter/Inputs/custom-modules/ProtoWithInitializer.h
./test/ClangImporter/Inputs/custom-modules/module.map
./test/ClangImporter/Inputs/custom-modules/PredefinedMacros.h
./test/ClangImporter/Inputs/custom-modules/ObjCParseExtrasTooHelper.h
./test/ClangImporter/Inputs/custom-modules/CInsideObjC.h
./test/ClangImporter/Inputs/custom-modules/Warnings3.h
./test/ClangImporter/Inputs/custom-modules/MacrosDeliberateRedefA
./test/ClangImporter/Inputs/custom-modules/MacrosDeliberateRedefA/Old.h
./test/ClangImporter/Inputs/custom-modules/MacrosDeliberateRedefA/New.h
./test/ClangImporter/Inputs/custom-modules/MacrosDeliberateRedefA/module.modulemap
./test/ClangImporter/Inputs/custom-modules/ImageInitializers.h
./test/ClangImporter/Inputs/custom-modules/Warnings9.h
./test/ClangImporter/Inputs/custom-modules/IndirectFrameworkImporter.h
./test/ClangImporter/Inputs/custom-modules/ObjCIRExtras.h
./test/ClangImporter/Inputs/custom-modules/RedeclaredProperties
./test/ClangImporter/Inputs/custom-modules/RedeclaredProperties/RedeclaredProperties.h
./test/ClangImporter/Inputs/custom-modules/RedeclaredProperties/RPSecond.h
./test/ClangImporter/Inputs/custom-modules/RedeclaredProperties/RPFirst.h
./test/ClangImporter/Inputs/custom-modules/RedeclaredProperties/RedeclaredPropertiesSub.h
./test/ClangImporter/Inputs/custom-modules/RedeclaredProperties/RedeclaredPropertiesSubPrivate.h
./test/ClangImporter/Inputs/custom-modules/RedeclaredProperties/RedeclaredPropertiesSplit2.h
./test/ClangImporter/Inputs/custom-modules/RedeclaredProperties/RedeclaredPropertiesSplit.h
./test/ClangImporter/Inputs/custom-modules/RedeclaredProperties/module.modulemap
./test/ClangImporter/Inputs/custom-modules/more-custom-modules
./test/ClangImporter/Inputs/custom-modules/more-custom-modules/ImportsMissingHeaderIndirect.h
./test/ClangImporter/Inputs/custom-modules/more-custom-modules/module.map
./test/ClangImporter/Inputs/custom-modules/MacrosRedefA.h
./test/ClangImporter/Inputs/custom-modules/Warnings7.h
./test/ClangImporter/Inputs/custom-modules/CFAndObjC.h
./test/ClangImporter/Inputs/custom-modules/ProtoRenaming.h
./test/ClangImporter/Inputs/custom-modules/UnimportableMembersUser.h
./test/ClangImporter/Inputs/custom-modules/ctypes_bits_exported.h
./test/ClangImporter/Inputs/custom-modules/EnumExhaustivity.apinotes
./test/ClangImporter/Inputs/custom-modules/LocalVsFileScopeBase.h
./test/ClangImporter/Inputs/custom-modules/ObjCParseExtras.apinotes
./test/ClangImporter/Inputs/custom-modules/ImportAsMember.apinotes
./test/ClangImporter/Inputs/custom-modules/UnimportableMembers.h
./test/ClangImporter/Inputs/custom-modules/ImportAsMember.h
./test/ClangImporter/Inputs/custom-modules/EnumExhaustivity.h
./test/ClangImporter/Inputs/custom-modules/MacrosRedefWithSubmodules
./test/ClangImporter/Inputs/custom-modules/MacrosRedefWithSubmodules/module.modulemap
./test/ClangImporter/Inputs/custom-modules/MacrosRedefWithSubmodules/Outer.h
./test/ClangImporter/Inputs/custom-modules/MacrosRedefWithSubmodules/Inner.h
./test/ClangImporter/Inputs/custom-modules/NSManagedObject.h
./test/ClangImporter/Inputs/custom-modules/ClangModuleUser.h
./test/ClangImporter/Inputs/custom-modules/Redeclaration.h
./test/ClangImporter/Inputs/custom-modules/TypeAndValue.h
./test/ClangImporter/Inputs/custom-modules/Warnings4.h
./test/ClangImporter/Inputs/custom-modules/IndirectFields.h
./test/ClangImporter/Inputs/custom-modules/MacrosRedefB.h
./test/ClangImporter/Inputs/custom-modules/RedeclaredErrorEnum
./test/ClangImporter/Inputs/custom-modules/RedeclaredErrorEnum/Redeclared.h
./test/ClangImporter/Inputs/custom-modules/RedeclaredErrorEnum/module.modulemap
./test/ClangImporter/Inputs/custom-modules/RedeclaredErrorEnum/Base.h
./test/ClangImporter/Inputs/custom-modules/AvailabilityExtras.h
./test/ClangImporter/Inputs/custom-modules/x.h
./test/ClangImporter/Inputs/custom-modules/Newtype.h
./test/ClangImporter/Inputs/custom-modules/SwiftPrivateAttr.h
./test/ClangImporter/Inputs/custom-modules/cxx_interop.h
./test/ClangImporter/Inputs/custom-modules/BlocksReturningBool.h
./test/ClangImporter/Inputs/custom-modules/ObjCSubscripts.h
./test/ClangImporter/Inputs/custom-modules/CoreCooling.h
./test/ClangImporter/Inputs/objc_nsmanaged_other.swift
./test/ClangImporter/Inputs/other.swift
./test/ClangImporter/Inputs/privateframeworks
./test/ClangImporter/Inputs/privateframeworks/withoutprivate
./test/ClangImporter/Inputs/privateframeworks/withoutprivate/SomeKit.framework
./test/ClangImporter/Inputs/privateframeworks/withoutprivate/SomeKit.framework/Headers
./test/ClangImporter/Inputs/privateframeworks/withoutprivate/SomeKit.framework/Headers/SomeKit.h
./test/ClangImporter/Inputs/privateframeworks/withoutprivate/SomeKit.framework/Headers/SKWidget.h
./test/ClangImporter/Inputs/privateframeworks/withoutprivate/SomeKit.framework/Headers/SomeKit.apinotes
./test/ClangImporter/Inputs/privateframeworks/withoutprivate/SomeKit.framework/Modules
./test/ClangImporter/Inputs/privateframeworks/withoutprivate/SomeKit.framework/Modules/module.modulemap
./test/ClangImporter/Inputs/privateframeworks/withprivate-autolink
./test/ClangImporter/Inputs/privateframeworks/withprivate-autolink/SomeKitCore.framework
./test/ClangImporter/Inputs/privateframeworks/withprivate-autolink/SomeKitCore.framework/SomeKitCore.tbd
./test/ClangImporter/Inputs/privateframeworks/withprivate-autolink/SomeKitCore.framework/Headers
./test/ClangImporter/Inputs/privateframeworks/withprivate-autolink/SomeKitCore.framework/Headers/SKWidget.h
./test/ClangImporter/Inputs/privateframeworks/withprivate-autolink/SomeKitCore.framework/Headers/SomeKitCore.h
./test/ClangImporter/Inputs/privateframeworks/withprivate-autolink/SomeKitCore.framework/Modules
./test/ClangImporter/Inputs/privateframeworks/withprivate-autolink/SomeKitCore.framework/Modules/module.modulemap
./test/ClangImporter/Inputs/privateframeworks/withprivate-autolink/SomeKit.framework
./test/ClangImporter/Inputs/privateframeworks/withprivate-autolink/SomeKit.framework/Headers
./test/ClangImporter/Inputs/privateframeworks/withprivate-autolink/SomeKit.framework/Headers/SomeKit.h
./test/ClangImporter/Inputs/privateframeworks/withprivate-autolink/SomeKit.framework/Headers/SKWidget.h
./test/ClangImporter/Inputs/privateframeworks/withprivate-autolink/SomeKit.framework/SomeKit.tbd
./test/ClangImporter/Inputs/privateframeworks/withprivate-autolink/SomeKit.framework/Modules
./test/ClangImporter/Inputs/privateframeworks/withprivate-autolink/SomeKit.framework/Modules/module.modulemap
./test/ClangImporter/Inputs/privateframeworks/withprivate
./test/ClangImporter/Inputs/privateframeworks/withprivate/SomeKitCore.framework
./test/ClangImporter/Inputs/privateframeworks/withprivate/SomeKitCore.framework/Headers
./test/ClangImporter/Inputs/privateframeworks/withprivate/SomeKitCore.framework/Headers/SKWidget.h
./test/ClangImporter/Inputs/privateframeworks/withprivate/SomeKitCore.framework/Headers/SomeKitCore.apinotes
./test/ClangImporter/Inputs/privateframeworks/withprivate/SomeKitCore.framework/Headers/SomeKitCore.h
./test/ClangImporter/Inputs/privateframeworks/withprivate/SomeKitCore.framework/Modules
./test/ClangImporter/Inputs/privateframeworks/withprivate/SomeKitCore.framework/Modules/module.modulemap
./test/ClangImporter/Inputs/privateframeworks/withprivate/SomeKit.framework
./test/ClangImporter/Inputs/privateframeworks/withprivate/SomeKit.framework/Headers
./test/ClangImporter/Inputs/privateframeworks/withprivate/SomeKit.framework/Headers/SomeKit.h
./test/ClangImporter/Inputs/privateframeworks/withprivate/SomeKit.framework/Headers/SKWidget.h
./test/ClangImporter/Inputs/privateframeworks/withprivate/SomeKit.framework/Headers/SomeKit.apinotes
./test/ClangImporter/Inputs/privateframeworks/withprivate/SomeKit.framework/Modules
./test/ClangImporter/Inputs/privateframeworks/withprivate/SomeKit.framework/Modules/module.modulemap
./test/ClangImporter/Inputs/privateframeworks/bridging-somekitcore.h
./test/ClangImporter/Inputs/privateframeworks/overlay
./test/ClangImporter/Inputs/privateframeworks/overlay/SomeKit.swift
./test/ClangImporter/Inputs/privateframeworks/bridging-somekit.h
./test/ClangImporter/Inputs/inherited-protocols-sil.h
./test/ClangImporter/Inputs/availability_implicit_macosx_other.swift
./test/ClangImporter/Inputs/unit-test-bridging-header-to-pch.h
./test/ClangImporter/Inputs/frameworks
./test/ClangImporter/Inputs/frameworks/Simple.framework
./test/ClangImporter/Inputs/frameworks/Simple.framework/Simple
./test/ClangImporter/Inputs/frameworks/Simple.framework/Headers
./test/ClangImporter/Inputs/frameworks/Simple.framework/Headers/Simple.h
./test/ClangImporter/Inputs/frameworks/Simple.framework/Modules
./test/ClangImporter/Inputs/frameworks/Simple.framework/Modules/module.modulemap
./test/ClangImporter/Inputs/frameworks/MismatchedNames.framework
./test/ClangImporter/Inputs/frameworks/MismatchedNames.framework/Headers
./test/ClangImporter/Inputs/frameworks/MismatchedNames.framework/Headers/MismatchedNames-Swift.h
./test/ClangImporter/Inputs/frameworks/MismatchedNames.framework/Modules
./test/ClangImporter/Inputs/frameworks/MismatchedNames.framework/Modules/module.modulemap
./test/ClangImporter/Inputs/frameworks/MismatchedNames.framework/MismatchedNamesSwift.swift
./test/ClangImporter/Inputs/frameworks/PrivateAsParallel.framework
./test/ClangImporter/Inputs/frameworks/PrivateAsParallel.framework/PrivateHeaders
./test/ClangImporter/Inputs/frameworks/PrivateAsParallel.framework/PrivateHeaders/PrivateAsParallel_Priv.h
./test/ClangImporter/Inputs/frameworks/PrivateAsParallel.framework/Headers
./test/ClangImporter/Inputs/frameworks/PrivateAsParallel.framework/Headers/PrivateAsParallel.h
./test/ClangImporter/Inputs/frameworks/PrivateAsParallel.framework/Modules
./test/ClangImporter/Inputs/frameworks/PrivateAsParallel.framework/Modules/module.private.modulemap
./test/ClangImporter/Inputs/frameworks/PrivateAsParallel.framework/Modules/module.modulemap
./test/ClangImporter/Inputs/frameworks/CategoryOverrides.framework
./test/ClangImporter/Inputs/frameworks/CategoryOverrides.framework/PrivateHeaders
./test/ClangImporter/Inputs/frameworks/CategoryOverrides.framework/PrivateHeaders/Private.h
./test/ClangImporter/Inputs/frameworks/CategoryOverrides.framework/Headers
./test/ClangImporter/Inputs/frameworks/CategoryOverrides.framework/Headers/CategoryOverrides.h
./test/ClangImporter/Inputs/frameworks/CategoryOverrides.framework/Modules
./test/ClangImporter/Inputs/frameworks/CategoryOverrides.framework/Modules/module.modulemap
./test/ClangImporter/Inputs/frameworks/ImportAsMemberSubmodules.framework
./test/ClangImporter/Inputs/frameworks/ImportAsMemberSubmodules.framework/Headers
./test/ClangImporter/Inputs/frameworks/ImportAsMemberSubmodules.framework/Headers/Fwd.h
./test/ClangImporter/Inputs/frameworks/ImportAsMemberSubmodules.framework/Headers/ImportAsMemberSubmodules.h
./test/ClangImporter/Inputs/frameworks/ImportAsMemberSubmodules.framework/Headers/Actual.h
./test/ClangImporter/Inputs/frameworks/ImportAsMemberSubmodules.framework/Headers/ImportAsMemberSubmodules.apinotes
./test/ClangImporter/Inputs/frameworks/ImportAsMemberSubmodules.framework/Modules
./test/ClangImporter/Inputs/frameworks/ImportAsMemberSubmodules.framework/Modules/module.modulemap
./test/ClangImporter/Inputs/frameworks/PrivatelyReadwrite.framework
./test/ClangImporter/Inputs/frameworks/PrivatelyReadwrite.framework/PrivateHeaders
./test/ClangImporter/Inputs/frameworks/PrivatelyReadwrite.framework/PrivateHeaders/Private.h
./test/ClangImporter/Inputs/frameworks/PrivatelyReadwrite.framework/Headers
./test/ClangImporter/Inputs/frameworks/PrivatelyReadwrite.framework/Headers/PrivatelyReadwrite.h
./test/ClangImporter/Inputs/frameworks/PrivatelyReadwrite.framework/Modules
./test/ClangImporter/Inputs/frameworks/PrivatelyReadwrite.framework/Modules/module.modulemap
./test/ClangImporter/Inputs/frameworks/Module.framework
./test/ClangImporter/Inputs/frameworks/Module.framework/Module
./test/ClangImporter/Inputs/frameworks/Module.framework/Headers
./test/ClangImporter/Inputs/frameworks/Module.framework/Headers/Buried
./test/ClangImporter/Inputs/frameworks/Module.framework/Headers/Buried/Treasure.h
./test/ClangImporter/Inputs/frameworks/Module.framework/Headers/Sub.h
./test/ClangImporter/Inputs/frameworks/Module.framework/Headers/Sub2.h
./test/ClangImporter/Inputs/frameworks/Module.framework/Headers/Module.h
./test/ClangImporter/Inputs/frameworks/Module.framework/Headers/NotInModule.h
./test/ClangImporter/Inputs/frameworks/Module.framework/Modules
./test/ClangImporter/Inputs/frameworks/Module.framework/Modules/module.modulemap
./test/ClangImporter/Inputs/frameworks/Another.framework
./test/ClangImporter/Inputs/frameworks/Another.framework/Headers
./test/ClangImporter/Inputs/frameworks/Another.framework/Headers/Another.h
./test/ClangImporter/Inputs/frameworks/Another.framework/Modules
./test/ClangImporter/Inputs/frameworks/Another.framework/Modules/module.modulemap
./test/ClangImporter/Inputs/frameworks/Another.framework/Another
./test/ClangImporter/Inputs/frameworks/PrivateAsSubmodule.framework
./test/ClangImporter/Inputs/frameworks/PrivateAsSubmodule.framework/PrivateHeaders
./test/ClangImporter/Inputs/frameworks/PrivateAsSubmodule.framework/PrivateHeaders/PrivateAsSubmodule_Priv.h
./test/ClangImporter/Inputs/frameworks/PrivateAsSubmodule.framework/Headers
./test/ClangImporter/Inputs/frameworks/PrivateAsSubmodule.framework/Headers/PrivateAsSubmodule.h
./test/ClangImporter/Inputs/frameworks/PrivateAsSubmodule.framework/Modules
./test/ClangImporter/Inputs/frameworks/PrivateAsSubmodule.framework/Modules/module.private.modulemap
./test/ClangImporter/Inputs/frameworks/PrivateAsSubmodule.framework/Modules/module.modulemap
./test/ClangImporter/Inputs/pch-loading-error.h
./test/ClangImporter/Inputs/enum-new.h
./test/ClangImporter/Inputs/ibaction.h
./test/ClangImporter/Inputs/submodules-bridging-header.h
./test/ClangImporter/Inputs/MoreSwiftNewtypes_conformances.swift
./test/ClangImporter/Inputs/objc_init_generics.h
./test/ClangImporter/Inputs/cfuncs.swift
./test/ClangImporter/Inputs/serialization-sil.h
./test/ClangImporter/Inputs/no-nsobject-protocol.h
./test/ClangImporter/disable-modules-validate-system-headers.swift
./test/ClangImporter/no-import-objc.swift
./test/ClangImporter/availability_implicit_macosx.swift
./test/ClangImporter/serialization.swift
./test/ClangImporter/enum-error-redeclared.swift
./test/ClangImporter/macro_literals.swift
./test/ClangImporter/availability_ios.swift
./test/Incremental
./test/Incremental/Dependencies
./test/Incremental/Dependencies/reference-dependencies-members-fine.swift
./test/Incremental/Dependencies/reference-dependencies-consistency-fine.swift
./test/Incremental/Dependencies/private-var-fine.swift
./test/Incremental/Dependencies/reference-dependencies-dynamic-lookup-fine.swift
./test/Incremental/Dependencies/private-protocol-conformer-ext-fine.swift
./test/Incremental/Dependencies/reference-dependencies-fine.swift
./test/Incremental/Dependencies/private-struct-member-fine.swift
./test/Incremental/Dependencies/private-protocol-conformer-fine.swift
./test/Incremental/Dependencies/private-function-return-type-fine.swift
./test/Incremental/Dependencies/private-subscript-fine.swift
./test/Incremental/Dependencies/private-function-fine.swift
./test/Incremental/Dependencies/private-typealias-fine.swift
./test/Incremental/Dependencies/reference-dependencies-errors.swift
./test/Incremental/Dependencies/Inputs
./test/Incremental/Dependencies/Inputs/InterestingType.swift
./test/Incremental/PrivateDependencies
./test/Incremental/PrivateDependencies/reference-dependencies-members-fine.swift
./test/Incremental/PrivateDependencies/reference-dependencies-consistency-fine.swift
./test/Incremental/PrivateDependencies/private-var-fine.swift
./test/Incremental/PrivateDependencies/reference-dependencies-dynamic-lookup-fine.swift
./test/Incremental/PrivateDependencies/private-protocol-conformer-ext-fine.swift
./test/Incremental/PrivateDependencies/reference-dependencies-fine.swift
./test/Incremental/PrivateDependencies/private-struct-member-fine.swift
./test/Incremental/PrivateDependencies/private-protocol-conformer-fine.swift
./test/Incremental/PrivateDependencies/private-function-return-type-fine.swift
./test/Incremental/PrivateDependencies/private-subscript-fine.swift
./test/Incremental/PrivateDependencies/private-function-fine.swift
./test/Incremental/PrivateDependencies/private-typealias-fine.swift
./test/Incremental/PrivateDependencies/reference-dependencies-errors.swift
./test/Incremental/PrivateDependencies/Inputs
./test/Incremental/PrivateDependencies/Inputs/InterestingType.swift
./test/Incremental/Verifier
./test/Incremental/Verifier/multi-file
./test/Incremental/Verifier/multi-file/main.swift
./test/Incremental/Verifier/multi-file/Inputs
./test/Incremental/Verifier/multi-file/Inputs/Base.swift
./test/Incremental/Verifier/multi-file/Inputs/Inner.swift
./test/Incremental/Verifier/multi-file/Inputs/UsesInner.swift
./test/Incremental/Verifier/multi-file/Inputs/Derived.swift
./test/Incremental/Verifier/gen-output-file-map.py
./test/Incremental/Verifier/single-file
./test/Incremental/Verifier/single-file/Conformances.swift
./test/Incremental/Verifier/single-file/AnyObject.swift
./test/Incremental/Verifier/single-file-private
./test/Incremental/Verifier/single-file-private/Conformances.swift
./test/Incremental/Verifier/single-file-private/AnyObject.swift
./test/Incremental/Verifier/multi-file-private
./test/Incremental/Verifier/multi-file-private/main.swift
./test/Incremental/Verifier/multi-file-private/Inputs
./test/Incremental/Verifier/multi-file-private/Inputs/Base.swift
./test/Incremental/Verifier/multi-file-private/Inputs/Inner.swift
./test/Incremental/Verifier/multi-file-private/Inputs/UsesInner.swift
./test/Incremental/Verifier/multi-file-private/Inputs/Derived.swift
./test/Incremental/superfluous-cascade.swift
./test/Incremental/Inputs
./test/Incremental/Inputs/superfluous-cascade
./test/Incremental/Inputs/superfluous-cascade/ofm.json
./test/Incremental/Inputs/superfluous-cascade/definesPoint-before.swift
./test/Incremental/Inputs/superfluous-cascade/usesDisplay.swift
./test/Incremental/Inputs/superfluous-cascade/usesPoint.swift
./test/Incremental/Inputs/superfluous-cascade/definesPoint-after.swift
./test/Incremental/Inputs/superfluous-cascade/main.swift
./test/Incremental/Inputs/reference-dependencies-helper.swift
./test/Incremental/Inputs/reference-dependencies-members-helper.swift
./test/remote-run
./test/remote-run/env.test-sh
./test/remote-run/download.test-sh
./test/remote-run/upload-stderr.test-sh
./test/remote-run/dry-run-remote.test-sh
./test/remote-run/run-only.test-sh
./test/remote-run/upload-and-download.test-sh
./test/remote-run/exit-code.test-sh
./test/remote-run/upload.test-sh
./test/remote-run/identity.test-sh
./test/remote-run/stderr.test-sh
./test/remote-run/port.test-sh
./test/remote-run/lit.local.cfg
./test/remote-run/custom-options.test-sh
./test/remote-run/dry-run.test-sh
./test/remote-run/Inputs
./test/remote-run/Inputs/upload
./test/remote-run/Inputs/upload/BAD.txt
./test/remote-run/Inputs/upload/2.txt
./test/remote-run/Inputs/upload/1.txt
./test/DebuggerTestingTransform
./test/DebuggerTestingTransform/class.swift
./test/DebuggerTestingTransform/basic-assignments.swift
./test/Frontend
./test/Frontend/debug-diagnostic-names.swift
./test/Frontend/bad-vfs-overlays.swift
./test/Frontend/OptimizationOptions-without-stdlib-checks.swift
./test/Frontend/immediate-mode-no-output.swift
./test/Frontend/InternalChecks.swift
./test/Frontend/unknown-arguments.swift
./test/Frontend/dependencies-selective-supplementaries.swift
./test/Frontend/multiple_input.swift
./test/Frontend/dependencies-preservation-fine.swift
./test/Frontend/Xllvm.swift
./test/Frontend/wrong-number-of-arguments.swift
./test/Frontend/verify.swift
./test/Frontend/embed-bitcode-tvos.ll
./test/Frontend/invalid-target.swift
./test/Frontend/supplementary-output-support.swift
./test/Frontend/invalid-testable-import.swift
./test/Frontend/PrivateFingerprints
./test/Frontend/PrivateFingerprints/struct-fingerprint.swift
./test/Frontend/PrivateFingerprints/extension-adds-member.swift
./test/Frontend/PrivateFingerprints/enum-fingerprint.swift
./test/Frontend/PrivateFingerprints/class-fingerprint.swift
./test/Frontend/PrivateFingerprints/protocol-fingerprint.swift
./test/Frontend/PrivateFingerprints/Inputs
./test/Frontend/PrivateFingerprints/Inputs/class-fingerprint
./test/Frontend/PrivateFingerprints/Inputs/class-fingerprint/usesA.swift
./test/Frontend/PrivateFingerprints/Inputs/class-fingerprint/ofm.json
./test/Frontend/PrivateFingerprints/Inputs/class-fingerprint/usesB.swift
./test/Frontend/PrivateFingerprints/Inputs/class-fingerprint/main.swift
./test/Frontend/PrivateFingerprints/Inputs/class-fingerprint/definesAB-after.swift
./test/Frontend/PrivateFingerprints/Inputs/class-fingerprint/definesAB-before.swift
./test/Frontend/PrivateFingerprints/Inputs/protocol-fingerprint
./test/Frontend/PrivateFingerprints/Inputs/protocol-fingerprint/usesA.swift
./test/Frontend/PrivateFingerprints/Inputs/protocol-fingerprint/ofm.json
./test/Frontend/PrivateFingerprints/Inputs/protocol-fingerprint/usesB.swift
./test/Frontend/PrivateFingerprints/Inputs/protocol-fingerprint/main.swift
./test/Frontend/PrivateFingerprints/Inputs/protocol-fingerprint/definesAB-after.swift
./test/Frontend/PrivateFingerprints/Inputs/protocol-fingerprint/definesAB-before.swift
./test/Frontend/PrivateFingerprints/Inputs/extension-adds-member
./test/Frontend/PrivateFingerprints/Inputs/extension-adds-member/usesA.swift
./test/Frontend/PrivateFingerprints/Inputs/extension-adds-member/ofm.json
./test/Frontend/PrivateFingerprints/Inputs/extension-adds-member/usesB.swift
./test/Frontend/PrivateFingerprints/Inputs/extension-adds-member/main.swift
./test/Frontend/PrivateFingerprints/Inputs/extension-adds-member/definesAB-after.swift
./test/Frontend/PrivateFingerprints/Inputs/extension-adds-member/definesAB-before.swift
./test/Frontend/PrivateFingerprints/Inputs/struct-fingerprint
./test/Frontend/PrivateFingerprints/Inputs/struct-fingerprint/usesA.swift
./test/Frontend/PrivateFingerprints/Inputs/struct-fingerprint/ofm.json
./test/Frontend/PrivateFingerprints/Inputs/struct-fingerprint/usesB.swift
./test/Frontend/PrivateFingerprints/Inputs/struct-fingerprint/main.swift
./test/Frontend/PrivateFingerprints/Inputs/struct-fingerprint/definesAB-after.swift
./test/Frontend/PrivateFingerprints/Inputs/struct-fingerprint/definesAB-before.swift
./test/Frontend/PrivateFingerprints/Inputs/enum-fingerprint
./test/Frontend/PrivateFingerprints/Inputs/enum-fingerprint/usesA.swift
./test/Frontend/PrivateFingerprints/Inputs/enum-fingerprint/ofm.json
./test/Frontend/PrivateFingerprints/Inputs/enum-fingerprint/usesB.swift
./test/Frontend/PrivateFingerprints/Inputs/enum-fingerprint/main.swift
./test/Frontend/PrivateFingerprints/Inputs/enum-fingerprint/definesAB-after.swift
./test/Frontend/PrivateFingerprints/Inputs/enum-fingerprint/definesAB-before.swift
./test/Frontend/no-cmo-with-tbd.swift
./test/Frontend/crash-in-user-code.swift
./test/Frontend/emit-plus-zero-normal-arguments.swift
./test/Frontend/batch_mode_output_file_map_yaml_parse_error.swift
./test/Frontend/output.swift
./test/Frontend/batch_mode_module_file_names_as_main_output.swift
./test/Frontend/batch_mode_output_file_map_missing_primary.swift
./test/Frontend/skip-non-inlinable-function-bodies.swift
./test/Frontend/sil-merge-partial-modules-stdlib.swift
./test/Frontend/dependencies-fine.swift
./test/Frontend/verify-fixits.swift
./test/Frontend/clang-args-diags.swift
./test/Frontend/crash.swift
./test/Frontend/OptimizationOptions-with-stdlib-checks.swift
./test/Frontend/emit-module-path-wmo.swift
./test/Frontend/Fingerprints
./test/Frontend/Fingerprints/struct-fingerprint.swift
./test/Frontend/Fingerprints/extension-adds-member.swift
./test/Frontend/Fingerprints/enum-fingerprint.swift
./test/Frontend/Fingerprints/class-fingerprint.swift
./test/Frontend/Fingerprints/protocol-fingerprint.swift
./test/Frontend/Fingerprints/Inputs
./test/Frontend/Fingerprints/Inputs/class-fingerprint
./test/Frontend/Fingerprints/Inputs/class-fingerprint/usesA.swift
./test/Frontend/Fingerprints/Inputs/class-fingerprint/ofm.json
./test/Frontend/Fingerprints/Inputs/class-fingerprint/usesB.swift
./test/Frontend/Fingerprints/Inputs/class-fingerprint/main.swift
./test/Frontend/Fingerprints/Inputs/class-fingerprint/definesAB-after.swift
./test/Frontend/Fingerprints/Inputs/class-fingerprint/definesAB-before.swift
./test/Frontend/Fingerprints/Inputs/protocol-fingerprint
./test/Frontend/Fingerprints/Inputs/protocol-fingerprint/usesA.swift
./test/Frontend/Fingerprints/Inputs/protocol-fingerprint/ofm.json
./test/Frontend/Fingerprints/Inputs/protocol-fingerprint/usesB.swift
./test/Frontend/Fingerprints/Inputs/protocol-fingerprint/main.swift
./test/Frontend/Fingerprints/Inputs/protocol-fingerprint/definesAB-after.swift
./test/Frontend/Fingerprints/Inputs/protocol-fingerprint/definesAB-before.swift
./test/Frontend/Fingerprints/Inputs/extension-adds-member
./test/Frontend/Fingerprints/Inputs/extension-adds-member/usesA.swift
./test/Frontend/Fingerprints/Inputs/extension-adds-member/ofm.json
./test/Frontend/Fingerprints/Inputs/extension-adds-member/usesB.swift
./test/Frontend/Fingerprints/Inputs/extension-adds-member/main.swift
./test/Frontend/Fingerprints/Inputs/extension-adds-member/definesAB-after.swift
./test/Frontend/Fingerprints/Inputs/extension-adds-member/definesAB-before.swift
./test/Frontend/Fingerprints/Inputs/struct-fingerprint
./test/Frontend/Fingerprints/Inputs/struct-fingerprint/usesA.swift
./test/Frontend/Fingerprints/Inputs/struct-fingerprint/ofm.json
./test/Frontend/Fingerprints/Inputs/struct-fingerprint/usesB.swift
./test/Frontend/Fingerprints/Inputs/struct-fingerprint/main.swift
./test/Frontend/Fingerprints/Inputs/struct-fingerprint/definesAB-after.swift
./test/Frontend/Fingerprints/Inputs/struct-fingerprint/definesAB-before.swift
./test/Frontend/Fingerprints/Inputs/enum-fingerprint
./test/Frontend/Fingerprints/Inputs/enum-fingerprint/usesA.swift
./test/Frontend/Fingerprints/Inputs/enum-fingerprint/ofm.json
./test/Frontend/Fingerprints/Inputs/enum-fingerprint/usesB.swift
./test/Frontend/Fingerprints/Inputs/enum-fingerprint/main.swift
./test/Frontend/Fingerprints/Inputs/enum-fingerprint/definesAB-after.swift
./test/Frontend/Fingerprints/Inputs/enum-fingerprint/definesAB-before.swift
./test/Frontend/filelist.swift
./test/Frontend/dump-parse.swift
./test/Frontend/verify-broken-c-module.swift
./test/Frontend/no-inputs.swift
./test/Frontend/test_datalayout.ll
./test/Frontend/embed-bitcode.ll
./test/Frontend/primary-filelist.swift
./test/Frontend/parse-sil-inputs.swift
./test/Frontend/vfs.swift
./test/Frontend/embed-bitcode.swift
./test/Frontend/sil-primary-file-with-sib.swift
./test/Frontend/input-errors.swift
./test/Frontend/ast-dump.swift
./test/Frontend/invalid-module-name.swift
./test/Frontend/debug-output.swift
./test/Frontend/batch-mode.swift
./test/Frontend/enforce-exclusivity.swift
./test/Frontend/debug-generic-signatures.swift
./test/Frontend/sil-merge-partial-modules.swift
./test/Frontend/emit-syntax.swift
./test/Frontend/Inputs
./test/Frontend/Inputs/vfs
./test/Frontend/Inputs/vfs/triple-mapped-swift-file
./test/Frontend/Inputs/vfs/a-modulemap
./test/Frontend/Inputs/vfs/tertiary-vfsoverlay.yaml
./test/Frontend/Inputs/vfs/secondary-vfsoverlay.yaml
./test/Frontend/Inputs/vfs/a-header
./test/Frontend/Inputs/vfs/vfsoverlay.yaml
./test/Frontend/Inputs/vfs/quaternary-vfsoverlay.yaml
./test/Frontend/Inputs/vfs/a-swift-file
./test/Frontend/Inputs/vfs/b-header
./test/Frontend/Inputs/filelist-other.swift
./test/Frontend/Inputs/sil-primary-file-with-sib.sil
./test/Frontend/Inputs/multiple_input
./test/Frontend/Inputs/multiple_input/lib.swift
./test/Frontend/Inputs/multiple_input/main.swift
./test/Frontend/Inputs/single_int.swift
./test/Frontend/Inputs/dependencies
./test/Frontend/Inputs/dependencies/extra-header.h
./test/Frontend/Inputs/dependencies/UserClangModule.h
./test/Frontend/Inputs/dependencies/module.modulemap
./test/Frontend/Inputs/dependencies/$$$$$.h
./test/Frontend/Inputs/invalid-overlay.yaml
./test/Frontend/Inputs/broken-c-module
./test/Frontend/Inputs/broken-c-module/broken_c.h
./test/Frontend/Inputs/broken-c-module/module.modulemap
./test/Frontend/Inputs/bad_output_filemap.yaml
./test/Frontend/Inputs/sil-merge-partial-modules-other.swift
./test/Frontend/Inputs/invalid-module-name.swift
./test/Frontend/Inputs/supplementary_output_filemap_missing_a_primary.yaml
./test/Frontend/Inputs/invalid.module.name.swift
./test/Frontend/ir-support-codegen.ll
./test/InterfaceHash
./test/InterfaceHash/edited_property_getter-type-fingerprints.swift
./test/InterfaceHash/added_private_method-type-fingerprints.swift
./test/InterfaceHash/added_localfunc.swift
./test/InterfaceHash/added_private_protocol_method.swift
./test/InterfaceHash/added_private_class_property-type-fingerprints.swift
./test/InterfaceHash/added_private_enum_private_property-type-fingerprints.swift
./test/InterfaceHash/added_function.swift
./test/InterfaceHash/added_private_class_private_property.swift
./test/InterfaceHash/added_private_method_value_types-type-fingerprints.swift
./test/InterfaceHash/added_private_struct_property.swift
./test/InterfaceHash/added_private_method.swift
./test/InterfaceHash/edited_method_body.swift
./test/InterfaceHash/added_private_protocol_property-type-fingerprints.swift
./test/InterfaceHash/edited_method_body-type-fingerprints.swift
./test/InterfaceHash/added_private_class_private_property-type-fingerprints.swift
./test/InterfaceHash/added_private_struct_private_property.swift
./test/InterfaceHash/added_method-type-fingerprints.swift
./test/InterfaceHash/added_private_struct_property-type-fingerprints.swift
./test/InterfaceHash/changed_var_name.swift
./test/InterfaceHash/added_private_method_value_types.swift
./test/InterfaceHash/added_private_enum_property-type-fingerprints.swift
./test/InterfaceHash/added_private_enum_property.swift
./test/InterfaceHash/added_private_class_property.swift
./test/InterfaceHash/changed_private_var_type.swift
./test/InterfaceHash/changed_var_type.swift
./test/InterfaceHash/added_private_protocol_method-type-fingerprints.swift
./test/InterfaceHash/added_private_protocol_property.swift
./test/InterfaceHash/edited_function_body.swift
./test/InterfaceHash/edited_property_getter.swift
./test/InterfaceHash/added_private_enum_private_property.swift
./test/InterfaceHash/added_method.swift
./test/InterfaceHash/added_private_struct_private_property-type-fingerprints.swift
./test/Constraints
./test/Constraints/sr12964.swift
./test/Constraints/common_type_objc.swift
./test/Constraints/collection-mutablecollection-order-dependency-1g.swift
./test/Constraints/disambiguate_iuo_param.swift
./test/Constraints/one_way_closure_params.swift
./test/Constraints/diag_ambiguities_module.swift
./test/Constraints/construction.swift
./test/Constraints/array_literal.swift
./test/Constraints/existential_metatypes.swift
./test/Constraints/function_builder_opaque_result.swift
./test/Constraints/invalid_archetype_constraint.swift
./test/Constraints/members_objc.swift
./test/Constraints/assignment.swift
./test/Constraints/lvalues.swift
./test/Constraints/rdar45490737.swift
./test/Constraints/function_conversion.swift
./test/Constraints/rdar60898369.swift
./test/Constraints/function_builder_infer.swift
./test/Constraints/invalid_decl_ref.swift
./test/Constraints/imported-overload.swift
./test/Constraints/rdar44770297.swift
./test/Constraints/rdar37790062.swift
./test/Constraints/array_literal_local_array.swift
./test/Constraints/rdar42678836.swift
./test/Constraints/function_builder.swift
./test/Constraints/concrete-overload-required.swift
./test/Constraints/trailing_closures_objc.swift
./test/Constraints/sr7875.swift
./test/Constraints/common_type.swift
./test/Constraints/generic_construction_deduction.swift
./test/Constraints/associated_types.swift
./test/Constraints/one_way_constraints.swift
./test/Constraints/keypath_closure_conv_mismatch_generic.swift
./test/Constraints/iuo.swift
./test/Constraints/rdar44569159.swift
./test/Constraints/sr7425.swift
./test/Constraints/warn_long_compile.swift
./test/Constraints/casts_objc.swift
./test/Constraints/enum_cases.swift
./test/Constraints/keypath_dynamic_member_lookup.swift
./test/Constraints/generic_protocol_witness.swift
./test/Constraints/iuo_objc.swift
./test/Constraints/rdar62842651.swift
./test/Constraints/operator.swift
./test/Constraints/sr9102.swift
./test/Constraints/rdar37303482.swift
./test/Constraints/function_builder_one_way.swift
./test/Constraints/default_literals_swift4.swift
./test/Constraints/associated_self_types.swift
./test/Constraints/generic_super_constraint.swift
./test/Constraints/class_to_object_in_collection.swift
./test/Constraints/fixes.swift
./test/Constraints/bridging-nsnumber-and-nsvalue.swift.gyb
./test/Constraints/rdar38625824.swift
./test/Constraints/override.swift
./test/Constraints/mutating_members.swift
./test/Constraints/metatypes.swift
./test/Constraints/rdar40945329.swift
./test/Constraints/rdar32726044.swift
./test/Constraints/requirement_failures_in_contextual_type.swift
./test/Constraints/rdar44816848.swift
./test/Constraints/rdar38535743.swift
./test/Constraints/members.swift
./test/Constraints/rdar62890683.swift
./test/Constraints/subscript.swift
./test/Constraints/rdar39931475.swift
./test/Constraints/rdar39931339.swift
./test/Constraints/same_types.swift
./test/Constraints/invalid_metatype_bridging_header.swift
./test/Constraints/rdar36226874.swift
./test/Constraints/invalid_logicvalue_coercion.swift
./test/Constraints/overload.swift
./test/Constraints/add_with_nil.swift
./test/Constraints/patterns.swift
./test/Constraints/availability.swift
./test/Constraints/super_constructor.swift
./test/Constraints/conditionally_defined_types.swift
./test/Constraints/sr10914.swift
./test/Constraints/keypath_closure_conv_mismatch.swift
./test/Constraints/fast-operator-typechecking.swift
./test/Constraints/generic_overload.swift
./test/Constraints/inherited_generic_conformance.swift
./test/Constraints/without_actually_escaping.swift
./test/Constraints/operator_availability.swift
./test/Constraints/rdar45242032.swift
./test/Constraints/collection-of-function.swift
./test/Constraints/rdar35142121.swift
./test/Constraints/openExistential.swift
./test/Constraints/super_method.swift
./test/Constraints/rdar37291371.swift
./test/Constraints/sr5252.swift
./test/Constraints/function_builder_diags.swift
./test/Constraints/recursive_concrete_constraints.swift
./test/Constraints/argument_matching.swift
./test/Constraints/casts.swift
./test/Constraints/without_actually_escaping_no_errors.swift
./test/Constraints/collection-mutablecollection-order-dependency-2.swift
./test/Constraints/if_expr.swift
./test/Constraints/mutating_members_compat.swift
./test/Constraints/sr7098.swift
./test/Constraints/default_literals.swift
./test/Constraints/ErrorBridging.swift
./test/Constraints/diagnostics_swift4.swift
./test/Constraints/bridging_nonobjc.swift
./test/Constraints/protocols.swift
./test/Constraints/type_of.swift
./test/Constraints/sr10595.swift
./test/Constraints/sr12277.swift
./test/Constraints/sr10728.swift
./test/Constraints/unchecked_optional.swift
./test/Constraints/rdar46544601.swift
./test/Constraints/ranking.swift
./test/Constraints/function_builder_availability.swift
./test/Constraints/rdar47787705.swift
./test/Constraints/dependent_type_requirement_failure.swift
./test/Constraints/class.swift
./test/Constraints/rdar45415874.swift
./test/Constraints/bridging.swift
./test/Constraints/valid_implicit_conversions.swift
./test/Constraints/anyhashable-collection-cast.swift
./test/Constraints/sr12520.swift
./test/Constraints/overload_filtering_objc.swift
./test/Constraints/tuple_arguments.swift
./test/Constraints/one_way_solve.swift
./test/Constraints/rdar39401774.swift
./test/Constraints/overload_filtering.swift
./test/Constraints/diag_missing_arg.swift
./test/Constraints/rdar42056741.swift
./test/Constraints/keypath.swift
./test/Constraints/rdar39209245.swift
./test/Constraints/invalid_constraint_lookup.swift
./test/Constraints/invalid_stdlib.swift
./test/Constraints/tuple.swift
./test/Constraints/imported_rawValue_assignment.swift
./test/Constraints/closures.swift
./test/Constraints/tuple_shuffle.swift
./test/Constraints/valid_pointer_conversions.swift
./test/Constraints/tuple-arguments-unsupported.swift
./test/Constraints/generics.swift
./test/Constraints/invalid_implicit_conversions.swift
./test/Constraints/incomplete_function_ref.swift
./test/Constraints/collection-mutablecollection-order-dependency-3.swift
./test/Constraints/collection-mutablecollection-order-dependency-1.swift
./test/Constraints/tuple-arguments-supported.swift
./test/Constraints/sr4664.swift
./test/Constraints/sr9626.swift
./test/Constraints/dictionary_literal.swift
./test/Constraints/rdar37160679.swift
./test/Constraints/diag_ambiguities.swift
./test/Constraints/sr7884.swift
./test/Constraints/function.swift
./test/Constraints/suspicious_bit_casts.swift
./test/Constraints/gather_all_adjacencies.swift
./test/Constraints/diagnostics.swift
./test/Constraints/optional.swift
./test/Constraints/invalid_stdlib_2.swift
./test/Constraints/rdar45511837.swift
./test/Constraints/disfavored.swift
./test/Constraints/associated-types-mixed-explicit-inferred.swift
./test/Constraints/rdar46377919.swift
./test/Constraints/rdar62201037.swift
./test/Constraints/rdar40002266.swift
./test/Constraints/sr10906.swift
./test/Constraints/nested_generics.swift
./test/Constraints/Inputs
./test/Constraints/Inputs/PrivateObjC.swift
./test/Constraints/Inputs/overload.h
./test/Constraints/Inputs/invalid_metatype_bridging_header.h
./test/Constraints/Inputs/disambiguate_iuo_param.h
./test/Constraints/Inputs/has_ambiguities.swift
./test/Constraints/Inputs/keypath.swift
./test/Constraints/Inputs/imported_type.h
./test/Constraints/interpolation_segments.swift
./test/Constraints/type_of_verified.swift
./test/Constraints/keypath_closure_conv_mismatch_norettype.swift
./test/Constraints/rdar42750089.swift
./test/Constraints/keypath_swift_5.swift
./test/Constraints/weak.swift
./test/Constraints/dynamic_lookup.swift
./test/sil-func-extractor
./test/sil-func-extractor/functions_to_preserve
./test/sil-func-extractor/load-serialized-sil.swift
./test/sil-func-extractor/multiple-functions.sil
./test/sil-func-extractor/basic.sil
./test/sil-func-extractor/basic.swift
./test/SILGen
./test/SILGen/super_objc_class_method.swift
./test/SILGen/existential_erasure_mutating_covariant_self.swift
./test/SILGen/generic_local_property.swift
./test/SILGen/objc_bridging.swift
./test/SILGen/capture_typealias.swift
./test/SILGen/unsafevalue.swift
./test/SILGen/protocol_cast_toplevel.swift
./test/SILGen/witnesses_inheritance.swift
./test/SILGen/private_import_other.swift
./test/SILGen/dynamic_self_reabstraction.swift
./test/SILGen/optional_chain_addressor.swift
./test/SILGen/erasure_reabstraction.swift
./test/SILGen/existential_metatypes.swift
./test/SILGen/property_wrappers_multifile.swift
./test/SILGen/objc_init_unavailable.swift
./test/SILGen/synthesized_conformance_enum.swift
./test/SILGen/assignment.swift
./test/SILGen/mangling_private.swift
./test/SILGen/partial_apply_apply.swift
./test/SILGen/objc_enum_unused_witnesses.swift
./test/SILGen/function_conversion.swift
./test/SILGen/deinit_in_vtable.swift
./test/SILGen/objc_imported_generic.swift
./test/SILGen/enum_raw_representable_objc.swift
./test/SILGen/objc_required_designated_init.swift
./test/SILGen/default_arguments_generic.swift
./test/SILGen/metatype_casts.swift
./test/SILGen/function_type_lowering_inherited_conformance.swift
./test/SILGen/capture-transitive.swift
./test/SILGen/UIApplicationMain.swift
./test/SILGen/sil_locations.swift
./test/SILGen/auto_generated_super_init_call.swift
./test/SILGen/properties_swift5.swift
./test/SILGen/protocol_extensions.swift
./test/SILGen/objc_bridging_peephole.swift
./test/SILGen/property_wrappers_constrained_extension.swift
./test/SILGen/objc_dealloc.swift
./test/SILGen/specialize_attr.swift
./test/SILGen/objc_dynamic_replacement.swift
./test/SILGen/concrete_subclass.swift
./test/SILGen/objc_bridged_results.swift
./test/SILGen/effectsattr.swift
./test/SILGen/capture_list.swift
./test/SILGen/guaranteed_closure_context.swift
./test/SILGen/addressors.swift
./test/SILGen/vtable_thunks_reabstraction_modify.swift
./test/SILGen/silgenbuilder_tuple_ownership.swift
./test/SILGen/weak_multiple_modules.swift
./test/SILGen/enum_debuginfo.swift
./test/SILGen/objc_extensions.swift
./test/SILGen/objc_currying.swift
./test/SILGen/nsmanaged-witness.swift
./test/SILGen/existential_erasure.swift
./test/SILGen/properties.swift
./test/SILGen/polymorphic_builtins.swift
./test/SILGen/global_init_attribute.swift
./test/SILGen/reabstract_lvalue.swift
./test/SILGen/metatype_object_conversion.swift
./test/SILGen/testable-multifile-other.swift
./test/SILGen/implicit_property_initializers.swift
./test/SILGen/dynamic_witness_other_module.swift
./test/SILGen/if_while_binding.swift
./test/SILGen/dynamic_callable_attribute.swift
./test/SILGen/generic_property_base_lifetime.swift
./test/SILGen/magic_identifier_file_conflicting.swift.gyb
./test/SILGen/objc_disable_brigding.swift
./test/SILGen/vtable_generic_signature.swift
./test/SILGen/objc_thunks.swift
./test/SILGen/mangling_retroactive.swift
./test/SILGen/metatype_in_init_delegation.swift
./test/SILGen/convenience_init_peer_delegation.swift
./test/SILGen/objc_factory_init.swift
./test/SILGen/magic_identifier_filepath.swift
./test/SILGen/protocol-extension-default-arg-existential-objc.swift
./test/SILGen/dynamic_lookup_throws.swift
./test/SILGen/switch-case-debug-descriptions.swift
./test/SILGen/access_marker_gen.swift
./test/SILGen/private_import.swift
./test/SILGen/subscripts.swift
./test/SILGen/objc_witnesses.swift
./test/SILGen/switch_bool.swift
./test/SILGen/apply_abstraction_nested.swift
./test/SILGen/function_conversion_objc.swift
./test/SILGen/objc_keypath.swift
./test/SILGen/modify_objc.swift
./test/SILGen/witness_tables_serialized_import.swift
./test/SILGen/objc_attr_NSManaged.swift
./test/SILGen/default_arguments_imported.swift
./test/SILGen/codable
./test/SILGen/codable/struct_codable_member_type_lookup.swift
./test/SILGen/convenience_init_peer_delegation_import.swift
./test/SILGen/argument_labels.swift
./test/SILGen/inherit_initializers.swift
./test/SILGen/switch_multiple_entry_address_only.swift
./test/SILGen/witnesses_class.swift
./test/SILGen/nsmanaged-witness-multi.swift
./test/SILGen/initializers.swift
./test/SILGen/objc_dictionary_bridging.swift
./test/SILGen/init_ref_delegation.swift
./test/SILGen/extensions_multifile.swift
./test/SILGen/capture_inout.swift
./test/SILGen/witnesses.swift
./test/SILGen/lifetime_nonmutating_address_only.swift
./test/SILGen/unicode_scalar_concat.swift
./test/SILGen/polymorphic_inout_aliasing.swift
./test/SILGen/global_resilience.swift
./test/SILGen/partial_apply_consuming_self.swift
./test/SILGen/objc_witnesses_serialized.swift
./test/SILGen/keypaths_inlinable.swift
./test/SILGen/for_loop_tuple_destructure_reabstraction.swift
./test/SILGen/keypaths_import_as_member.swift
./test/SILGen/super-to-nonobjc-extension.swift
./test/SILGen/enum_raw_representable_available.swift
./test/SILGen/keypaths_multi_file.swift
./test/SILGen/objc_error.swift
./test/SILGen/expressions.swift
./test/SILGen/objc_deprecated_objc_thunks.swift
./test/SILGen/synthesized_conformance_class.swift
./test/SILGen/shared.swift
./test/SILGen/fully-concrete-extension-of-generic.swift
./test/SILGen/foreign_errors.swift
./test/SILGen/mangling_generic_extensions.swift
./test/SILGen/conditionally_unreachable.swift
./test/SILGen/properties_swift4.swift
./test/SILGen/array_literal_abstraction.swift
./test/SILGen/unmanaged.swift
./test/SILGen/downcast_reabstraction.swift
./test/SILGen/NSApplicationMain.swift
./test/SILGen/reabstract-tuple.swift
./test/SILGen/testable-multifile.swift
./test/SILGen/dynamic.swift
./test/SILGen/metatype_abstraction.swift
./test/SILGen/witness_tables.swift
./test/SILGen/witness_tables_multifile.swift
./test/SILGen/builtins.swift
./test/SILGen/variant_overrides.swift
./test/SILGen/witness_tables_serialized.swift
./test/SILGen/enum_raw_representable.swift
./test/SILGen/objc_metatypes.swift
./test/SILGen/property_wrapper_coroutine_public.swift
./test/SILGen/generic_witness.swift
./test/SILGen/force_cast_chained_optional.swift
./test/SILGen/imported_struct_array_field.swift
./test/SILGen/unreachable_code.swift
./test/SILGen/cf_members.swift
./test/SILGen/class_resilience.swift
./test/SILGen/inout-existential-opened-type-function-conversion.swift
./test/SILGen/functions.swift
./test/SILGen/lifetime_unions.swift
./test/SILGen/static-stored-properties-in-concrete-contexts.swift
./test/SILGen/keypath_witness_overrides.swift
./test/SILGen/collection_downcast.swift
./test/SILGen/default_arguments_serialized.swift
./test/SILGen/final.swift
./test/SILGen/witness_table_overrides.swift
./test/SILGen/semanticsattr.swift
./test/SILGen/vtables.swift
./test/SILGen/statements.swift
./test/SILGen/objc_ownership_conventions.swift
./test/SILGen/dynamically_replaceable.swift
./test/SILGen/c_modify_linkage.swift
./test/SILGen/objc_final.swift
./test/SILGen/vtable_thunks.swift
./test/SILGen/lying_about_optional_return_objc.swift
./test/SILGen/cf.swift
./test/SILGen/objc_error_convention_from_protocol.swift
./test/SILGen/external-keypath.swift
./test/SILGen/metatypes.swift
./test/SILGen/partial_apply_generic.swift
./test/SILGen/generic_casts_swift4.swift
./test/SILGen/lazy_globals.swift
./test/SILGen/fragile_globals.swift
./test/SILGen/partial_apply_init.swift
./test/SILGen/keypath_property_descriptors.swift
./test/SILGen/tuple_attribute_reabstraction.swift
./test/SILGen/pointer_conversion.swift
./test/SILGen/lifetime.swift
./test/SILGen/indirect_enum.swift
./test/SILGen/protocol_resilience_objc.swift
./test/SILGen/witness-init-requirement-with-base-class-init.swift
./test/SILGen/capture_typed_boxes.swift
./test/SILGen/function_type_conversion.swift
./test/SILGen/lazy_global_access.swift
./test/SILGen/witnesses_canonical.swift
./test/SILGen/dynamic_accessors.swift
./test/SILGen/unsafe_pointer_gen.swift
./test/SILGen/address_only_types.swift
./test/SILGen/generic_tuples.swift
./test/SILGen/objc_bridged_generic_nonnull.swift
./test/SILGen/inline_always.swift
./test/SILGen/function_type_lowering.swift
./test/SILGen/objc_bridged_generic_conformance.swift
./test/SILGen/external_definitions.swift
./test/SILGen/opaque_values_silgen_lib.swift
./test/SILGen/closures_callee_guaranteed.swift
./test/SILGen/arguments.swift
./test/SILGen/didset_oldvalue_not_accessed_silgen.swift
./test/SILGen/call_as_function.swift
./test/SILGen/switch_resilience.swift
./test/SILGen/objc_enum.swift
./test/SILGen/lazy_property_with_observers.swift
./test/SILGen/opaque_result_type_underlying_type_abstraction.swift
./test/SILGen/source_location.swift
./test/SILGen/property_wrapper_coroutine.swift
./test/SILGen/objc_bridged_using_protocol_extension_impl.swift
./test/SILGen/top_level_captures.swift
./test/SILGen/inlinable_attribute_objc.swift
./test/SILGen/cf_curried_init.swift
./test/SILGen/boxed_existentials.swift
./test/SILGen/transparent_attribute.swift
./test/SILGen/property_wrappers_final.swift
./test/SILGen/import_as_member.swift
./test/SILGen/collection_subtype_upcast.swift
./test/SILGen/owned.swift
./test/SILGen/switch_ownership.swift
./test/SILGen/switch_fallthrough.swift
./test/SILGen/objc_subscript.swift
./test/SILGen/accessors.swift
./test/SILGen/default_arg_multiple_modules.swift
./test/SILGen/partial_apply_protocol_class_refinement_method.swift
./test/SILGen/switch_var.swift
./test/SILGen/inherited_protocol_conformance_multi_file_2.swift
./test/SILGen/capture-canonicalization.swift
./test/SILGen/objc_properties.swift
./test/SILGen/default_arguments.swift
./test/SILGen/extensions.swift
./test/SILGen/enum_resilience.swift
./test/SILGen/protocol_with_superclass_where_clause.swift
./test/SILGen/noescape_reabstraction.swift
./test/SILGen/subclass_existentials.swift
./test/SILGen/auto_closures_swift4.swift
./test/SILGen/mangling_retroactive_overlay.swift
./test/SILGen/opaque_result_type_class_property.swift
./test/SILGen/dynamic_self.swift
./test/SILGen/capture_resilience.swift
./test/SILGen/property_abstraction.swift
./test/SILGen/objc_dynamic_replacement_ext.swift
./test/SILGen/switch_debuginfo.swift
./test/SILGen/without_actually_escaping.swift
./test/SILGen/subscript_default_arguments.swift
./test/SILGen/weak_linked_attribute.swift
./test/SILGen/dynamic_init.swift
./test/SILGen/collection_subtype_downcast.swift
./test/SILGen/objc_nonnull_lie_hack.swift
./test/SILGen/lazy_globals_multiple_vars.swift
./test/SILGen/objc_protocol_native_thunk.swift
./test/SILGen/witness_accessibility_multi.swift
./test/SILGen/implicitly_unwrapped_optional.swift
./test/SILGen/opaque_result_type_fragile.swift
./test/SILGen/closure_inline_initializer.swift
./test/SILGen/copy_lvalue_peepholes.swift
./test/SILGen/closure_self_recursion.swift
./test/SILGen/cdecl.swift
./test/SILGen/objc_imported_init.swift
./test/SILGen/objc_generic_class.swift
./test/SILGen/rethrows.swift
./test/SILGen/extensions_objc.swift
./test/SILGen/vtable_implementation_only.swift
./test/SILGen/opaque_values_silgen_todo.swift
./test/SILGen/default_arguments_local.swift
./test/SILGen/optional_to_bool.swift
./test/SILGen/witness_accessibility.swift
./test/SILGen/enum_resilience_testable.swift
./test/SILGen/ivar_destroyer_resilience.swift
./test/SILGen/lazy_properties.swift
./test/SILGen/optional_lvalue.swift
./test/SILGen/property_wrapper_observers.swift
./test/SILGen/inherited_protocol_conformance_multi_file.swift
./test/SILGen/objc_bridging_any.swift
./test/SILGen/objc_local.swift
./test/SILGen/always_emit_into_client_attribute.swift
./test/SILGen/keypath_dynamic.swift
./test/SILGen/subscript_accessor.swift
./test/SILGen/function_conversion_se0110.swift
./test/SILGen/guaranteed_self.swift
./test/SILGen/keypaths_objc.swift
./test/SILGen/conditional_conformance.swift
./test/SILGen/tsan_instrumentation.swift
./test/SILGen/load_from_lvalue_in_plus_zero_context.swift
./test/SILGen/casts.swift
./test/SILGen/protocol_resilience.swift
./test/SILGen/newtype.swift
./test/SILGen/if_expr.swift
./test/SILGen/switch.swift
./test/SILGen/protocol_operators.swift
./test/SILGen/result_abstraction.swift
./test/SILGen/local_captures.swift
./test/SILGen/retaining_globals.swift
./test/SILGen/complete_object_init.swift
./test/SILGen/ivar_destroyer.swift
./test/SILGen/objc_bridged_block_optionality_diff.swift
./test/SILGen/protocols.swift
./test/SILGen/without_actually_escaping_block.swift
./test/SILGen/dso_handle.swift
./test/SILGen/switch_abstraction.swift
./test/SILGen/enum_generic_raw_value.swift
./test/SILGen/property_wrappers_library_evolution.swift
./test/SILGen/coroutine_subst_function_types.swift
./test/SILGen/call_chain_reabstraction.swift
./test/SILGen/mangling.swift
./test/SILGen/objc_super.swift
./test/SILGen/pound_assert.swift
./test/SILGen/default_arguments_inherited.swift
./test/SILGen/objc_attr_NSManaged_multi.swift
./test/SILGen/ivar_initializer.swift
./test/SILGen/nested_types_referencing_nested_functions.swift
./test/SILGen/interface_type_mangling.swift
./test/SILGen/protocol_optional.swift
./test/SILGen/super.swift
./test/SILGen/protocol_class_refinement.swift
./test/SILGen/borrow.swift
./test/SILGen/literals.swift
./test/SILGen/observers.swift
./test/SILGen/property_wrappers.swift
./test/SILGen/capture_order.swift
./test/SILGen/switch_isa.swift
./test/SILGen/mangling_ext_structA.swift
./test/SILGen/inlinable_attribute.swift
./test/SILGen/objc_protocols.swift
./test/SILGen/protocol_enum_witness.swift
./test/SILGen/scalar_to_tuple_args.swift
./test/SILGen/unmanaged_ownership.swift
./test/SILGen/tuples.swift
./test/SILGen/SILDeclRef.swift
./test/SILGen/keypaths.swift
./test/SILGen/sibling-nested-generic.swift
./test/SILGen/memberwise_init_temporary_allocations.swift
./test/SILGen/partial_apply_protocol.swift
./test/SILGen/generic_objc_block_bridge.swift
./test/SILGen/argument_shuffle.swift
./test/SILGen/witness_single_tuple.swift
./test/SILGen/magic_identifier_file.swift
./test/SILGen/synthesized_conformance_struct.swift
./test/SILGen/keypaths_resilient_generic.swift
./test/SILGen/enum_default_arguments.swift
./test/SILGen/external-associated-type-conformance.swift
./test/SILGen/generic_literals.swift
./test/SILGen/lit.local.cfg
./test/SILGen/objc_block_to_func_to_block.swift
./test/SILGen/switch_objc.swift
./test/SILGen/dynamic_self_reference_storage.swift
./test/SILGen/stored_property_default_arg.swift
./test/SILGen/writeback.swift
./test/SILGen/objc_bridging_array.swift
./test/SILGen/partial_apply_super.swift
./test/SILGen/opaque_ownership.swift
./test/SILGen/writeback_conflict_diagnostics.swift
./test/SILGen/functions_uninhabited_param.swift
./test/SILGen/closures.swift
./test/SILGen/dynamic_self_cast.swift
./test/SILGen/constrained_extensions.swift
./test/SILGen/import_as_member_cf.swift
./test/SILGen/objc_init_iuo_override.swift
./test/SILGen/opaque_result_type.swift
./test/SILGen/default_constructor.swift
./test/SILGen/keypath_application.swift
./test/SILGen/generic_casts.swift
./test/SILGen/let_decls_objc.swift
./test/SILGen/lying_about_optional_return.swift
./test/SILGen/errors.swift
./test/SILGen/toplevel_errors.swift
./test/SILGen/arguments_as_tuple_overloads.swift
./test/SILGen/availability_query.swift
./test/SILGen/sil_locations_top_level.swift
./test/SILGen/protocol_overrides.swift
./test/SILGen/switch_mixed_address_only_loadable.swift
./test/SILGen/required_init.swift
./test/SILGen/multi_file.swift
./test/SILGen/observers_with_on_demand_modify_accessor.swift
./test/SILGen/fixed_layout_attribute.swift
./test/SILGen/generic_signatures.swift
./test/SILGen/protocol-extension-default-arg-existential.swift
./test/SILGen/lazy_properties_multi.swift
./test/SILGen/partial_apply_throws.swift
./test/SILGen/swift_newtype_result_convention.swift
./test/SILGen/generic_closures.swift
./test/SILGen/function_builder_curry_thunks.swift
./test/SILGen/objc_bridging_nsstring.swift
./test/SILGen/decls.swift
./test/SILGen/function_type_lowering_objc.swift
./test/SILGen/auto_closures.swift
./test/SILGen/internal_protocol_refines_public_protocol_with_public_default_implementation.swift
./test/SILGen/local_types.swift
./test/SILGen/value_ownership_class.swift
./test/SILGen/objc_blocks_bridging.swift
./test/SILGen/let_decls.swift
./test/SILGen/guaranteed_normal_args.swift
./test/SILGen/optional-cast.swift
./test/SILGen/minimum_foreach.swift
./test/SILGen/unowned.swift
./test/SILGen/accessibility_vtables.swift
./test/SILGen/accessibility_warnings.swift
./test/SILGen/guaranteed-let-peephole-reabstraction.swift
./test/SILGen/local_recursion.swift
./test/SILGen/opaque_values_silgen.swift
./test/SILGen/resilient_assign_by_wrapper.swift
./test/SILGen/partial_apply_operator.swift
./test/SILGen/witness_same_type.swift
./test/SILGen/toplevel.swift
./test/SILGen/versioned_attribute.swift
./test/SILGen/optional.swift
./test/SILGen/same_type_across_generic_depths.swift
./test/SILGen/reabstract.swift
./test/SILGen/objc_dynamic_init.swift
./test/SILGen/enum_curry_thunks.swift
./test/SILGen/keypath_covariant_override.swift
./test/SILGen/vtable_thunks_reabstraction.swift
./test/SILGen/vtable_thunks_reabstraction_final.swift
./test/SILGen/win_bool_bridging.swift
./test/SILGen/magic_identifiers_inside_property_initializers.swift
./test/SILGen/tuple_conversion_refutable_pattern.swift
./test/SILGen/dependent_member_lowering.swift
./test/SILGen/types.swift
./test/SILGen/protocol_with_superclass.swift
./test/SILGen/opaque_type_lowering_in_substitution.swift
./test/SILGen/struct_resilience_testable.swift
./test/SILGen/ownership.swift
./test/SILGen/availability_attribute.swift
./test/SILGen/witnesses_refinement.swift
./test/SILGen/enum.swift
./test/SILGen/c_function_pointers.swift
./test/SILGen/value_ownership.swift
./test/SILGen/objc_bool_bridging.swift
./test/SILGen/modify_accessor.swift
./test/SILGen/same_type_abstraction.swift
./test/SILGen/closure_script_global_escape.swift
./test/SILGen/collection_upcast.swift
./test/SILGen/modify.swift
./test/SILGen/pointer_conversion_nonaccessing.swift
./test/SILGen/nested_generics.swift
./test/SILGen/foreach.swift
./test/SILGen/collection_cast_crash.swift
./test/SILGen/Inputs
./test/SILGen/Inputs/ModuleA.swift
./test/SILGen/Inputs/objc_bridged_block_optionality_diff.h
./test/SILGen/Inputs/dynamic_other.swift
./test/SILGen/Inputs/objc_dynamic_init.h
./test/SILGen/Inputs/switch_bool.h
./test/SILGen/Inputs/mangling_private_helper.swift
./test/SILGen/Inputs/ExternalKeyPaths.swift
./test/SILGen/Inputs/inherited_protocol_conformance_other_file.swift
./test/SILGen/Inputs/objc_enum_errortype.h
./test/SILGen/Inputs/objc_dynamic_replacement.swift
./test/SILGen/Inputs/usr
./test/SILGen/Inputs/usr/include
./test/SILGen/Inputs/usr/include/Gizmo.h
./test/SILGen/Inputs/usr/include/ObjectiveC.apinotes
./test/SILGen/Inputs/usr/include/BridgeTestFoundation.h
./test/SILGen/Inputs/usr/include/AppKit.h
./test/SILGen/Inputs/usr/include/objc_extensions_helper.h
./test/SILGen/Inputs/usr/include/module.map
./test/SILGen/Inputs/usr/include/NonNilTest.apinotes
./test/SILGen/Inputs/usr/include/CoreData.h
./test/SILGen/Inputs/usr/include/dispatch.h
./test/SILGen/Inputs/usr/include/Ansible.h
./test/SILGen/Inputs/usr/include/UIKit.h
./test/SILGen/Inputs/usr/include/newtype.h
./test/SILGen/Inputs/usr/include/NonNilTest.h
./test/SILGen/Inputs/usr/include/Foundation.apinotes
./test/SILGen/Inputs/usr/include/ObjectiveC.h
./test/SILGen/Inputs/usr/include/CoreCooling.h
./test/SILGen/Inputs/availability_overloads_other.swift
./test/SILGen/Inputs/objc_protocols_Bas.swift
./test/SILGen/Inputs/objc_block_to_func_to_block.h
./test/SILGen/Inputs/witness_tables_b.swift
./test/SILGen/Inputs/array_typedef.h
./test/SILGen/Inputs/private_import_module.swift
./test/SILGen/Inputs/objc_bridged_results.h
./test/SILGen/Inputs/keypaths_objc.h
./test/SILGen/Inputs/default_arg_other.swift
./test/SILGen/Inputs/nsmanaged-witness-multi-other.swift
./test/SILGen/Inputs/witness_accessibility_other.swift
./test/SILGen/Inputs/ModuleB.swift
./test/SILGen/Inputs/objc_required_designated_init.h
./test/SILGen/Inputs/property_wrapper_defs.swift
./test/SILGen/Inputs/witness_tables_multifile_2.swift
./test/SILGen/Inputs/objc_bridged_generic_nonnull.h
./test/SILGen/Inputs/keypaths_import_as_member.h
./test/SILGen/Inputs/ObjectiveC.swift
./test/SILGen/Inputs/BoolBridgingTests.h
./test/SILGen/Inputs/multi_file_helper.swift
./test/SILGen/Inputs/globals.h
./test/SILGen/Inputs/lazy_properties_other.swift
./test/SILGen/Inputs/AppKit.swift
./test/SILGen/Inputs/objc_dynamic_replacement_ext.swift
./test/SILGen/Inputs/block_property_in_objc_class.h
./test/SILGen/Inputs/ivar_initializer_other.swift
./test/SILGen/Inputs/TestableMultifileHelper.swift
./test/SILGen/Inputs/inherited_protocol_conformance_other_file_2_c.swift
./test/SILGen/Inputs/objc_required_designated_init_2.swift
./test/SILGen/Inputs/RetroactiveB.swift
./test/SILGen/Inputs/magic_identifier_file_conflicting_other.swift
./test/SILGen/Inputs/Foundation.swift
./test/SILGen/Inputs/enum_debuginfo_other.swift
./test/SILGen/Inputs/objc_init_unavailable.h
./test/SILGen/Inputs/external-associated-type-conformance.h
./test/SILGen/Inputs/weak_other.swift
./test/SILGen/Inputs/opaque_result_type_fragile_other.swift
./test/SILGen/Inputs/Dispatch.swift
./test/SILGen/Inputs/convenience_init_peer_delegation_import.h
./test/SILGen/Inputs/accessibility_vtables_other.swift
./test/SILGen/Inputs/UIKit.swift
./test/SILGen/Inputs/vtables_multifile_2.swift
./test/SILGen/Inputs/c_function_pointer_in_c_struct.h
./test/SILGen/Inputs/swift_newtype_result_convention.h
./test/SILGen/Inputs/keypaths_multi_file_b.swift
./test/SILGen/Inputs/objc_error_convention_from_protocol.h
./test/SILGen/Inputs/struct_with_initializer.swift
./test/SILGen/Inputs/availability_optionals_other.swift
./test/SILGen/Inputs/inherited_protocol_conformance_other_file_2_b.swift
./test/SILGen/Inputs/errors_other.swift
./test/SILGen/Inputs/dynamic_witness_other_module_other.swift
./test/SILGen/Inputs/protocol_overrides.swift
./test/SILGen/Inputs/UIApplicationMain-helper.swift
./test/SILGen/Inputs/def_global.swift
./test/SILGen/Inputs/always_emit_into_client_other_file.swift
./test/SILGen/Inputs/property_wrappers_multifile_other.swift
./test/SILGen/Inputs/default_arguments_other.swift
./test/SILGen/Inputs/objc_init_iuo_override.h
./test/SILGen/Inputs/modify_objc.h
./test/SILGen/Inputs/RetroactiveA.swift
./test/SILGen/Inputs/keypaths_multi_file_c.swift
./test/SILGen/Inputs/vtables_multifile_3.swift
./test/SILGen/Inputs/accessibility_vtables_helper.swift
./test/SILGen/Inputs/objc_witnesses_serialized.h
./test/SILGen/Inputs/objc_bridged_generic_conformance.h
./test/SILGen/Inputs/def_structA.swift
./test/SILGen/struct_resilience.swift
./test/SILGen/objc_init_ref_delegation.swift
./test/SILGen/objc_selector.swift
./test/SILGen/availability_overloads.swift
./test/SILGen/vtables_objc.swift
./test/SILGen/super_init_refcounting.swift
./test/SILGen/pointer_conversion_nonaccessing_objc.swift
./test/SILGen/optional_to_optional.swift
./test/SILGen/class_bound_protocols.swift
./test/SILGen/partial_apply_override.swift
./test/SILGen/vtables_multifile.swift
./test/SILGen/weak.swift
./test/SILGen/read_accessor.swift
./test/SILGen/objc_set_bridging.swift
./test/SILGen/dynamic_lookup.swift
./test/SILGen/guaranteed_normal_args_curry_thunks.swift
./test/AutoDiff
./test/AutoDiff/SILOptimizer
./test/AutoDiff/SILOptimizer/differentiability_witness_inlining.sil
./test/AutoDiff/SILOptimizer/activity_analysis.swift
./test/AutoDiff/SILOptimizer/differentiation_function_canonicalization.sil
./test/AutoDiff/SILOptimizer/differentiation_control_flow_diagnostics.swift
./test/AutoDiff/SILOptimizer/differentiation.swift
./test/AutoDiff/SILOptimizer/differentiation_sil.swift
./test/AutoDiff/SILOptimizer/semantic_member_accessors_sil.swift
./test/AutoDiff/SILOptimizer/property_wrappers.swift
./test/AutoDiff/SILOptimizer/derivative_sil.swift
./test/AutoDiff/SILOptimizer/differentiation_subset_parameters_thunk.swift
./test/AutoDiff/SILOptimizer/differentiation_diagnostics.swift
./test/AutoDiff/SILOptimizer/differentiation_diagnostics_cross_file.swift
./test/AutoDiff/SILOptimizer/differentiation_control_flow_sil.swift
./test/AutoDiff/SILOptimizer/Inputs
./test/AutoDiff/SILOptimizer/Inputs/nontrivial_loadable_type.swift
./test/AutoDiff/SILOptimizer/Inputs/differentiation_diagnostics_other_file.swift
./test/AutoDiff/validation-test
./test/AutoDiff/validation-test/cross_module_differentiation.swift
./test/AutoDiff/validation-test/array.swift
./test/AutoDiff/validation-test/simple_model.swift
./test/AutoDiff/validation-test/existential.swift
./test/AutoDiff/validation-test/zero_tangent_vector_initializer.swift
./test/AutoDiff/validation-test/control_flow.swift
./test/AutoDiff/validation-test/forward_mode.swift
./test/AutoDiff/validation-test/method.swift
./test/AutoDiff/validation-test/property_wrappers.swift
./test/AutoDiff/validation-test/superset_adjoint.swift
./test/AutoDiff/validation-test/subset_parameters_thunk.swift
./test/AutoDiff/validation-test/cross_module_derivative_attr.swift
./test/AutoDiff/validation-test/derivative_registration.swift
./test/AutoDiff/validation-test/differentiable_property.swift
./test/AutoDiff/validation-test/reabstraction.swift
./test/AutoDiff/validation-test/custom_derivatives.swift
./test/AutoDiff/validation-test/separate_tangent_type.swift
./test/AutoDiff/validation-test/repeated_calls.swift
./test/AutoDiff/validation-test/Inputs
./test/AutoDiff/validation-test/Inputs/cross_module_derivative_attr
./test/AutoDiff/validation-test/Inputs/cross_module_derivative_attr/main
./test/AutoDiff/validation-test/Inputs/cross_module_derivative_attr/main/main.swift
./test/AutoDiff/validation-test/Inputs/cross_module_derivative_attr/module1
./test/AutoDiff/validation-test/Inputs/cross_module_derivative_attr/module1/module1.swift
./test/AutoDiff/validation-test/Inputs/cross_module_derivative_attr/module1/module1_other_file.swift
./test/AutoDiff/validation-test/Inputs/cross_module_differentiation_other.swift
./test/AutoDiff/validation-test/simple_math.swift
./test/AutoDiff/SILGen
./test/AutoDiff/SILGen/differentiable_function.swift
./test/AutoDiff/SILGen/witness_table.swift
./test/AutoDiff/SILGen/noderivative_attr.swift
./test/AutoDiff/SILGen/sil_differentiability_witness.swift
./test/AutoDiff/SILGen/vtable.swift
./test/AutoDiff/SILGen/mangling.swift
./test/AutoDiff/SILGen/reabstraction.swift
./test/AutoDiff/SILGen/noderivative_attr_cross_file.swift
./test/AutoDiff/SILGen/autodiff_builtins.swift
./test/AutoDiff/SILGen/Inputs
./test/AutoDiff/SILGen/Inputs/noderivative_attr_other_file.swift
./test/AutoDiff/Serialization
./test/AutoDiff/Serialization/differentiable_function.swift
./test/AutoDiff/Serialization/differentiable_attr.swift
./test/AutoDiff/Serialization/transpose_attr.swift
./test/AutoDiff/Serialization/derivative_attr.swift
./test/AutoDiff/Parse
./test/AutoDiff/Parse/differentiable_attr_parse.swift
./test/AutoDiff/Parse/transpose_attr_parse.swift
./test/AutoDiff/Parse/derivative_attr_parse.swift
./test/AutoDiff/Parse/differentiable_func_type.swift
./test/AutoDiff/ModuleInterface
./test/AutoDiff/ModuleInterface/differentiation.swift
./test/AutoDiff/compiler_crashers
./test/AutoDiff/compiler_crashers/tf1181-apply-opened-opened-existential-argument.swift
./test/AutoDiff/compiler_crashers/sr12656-differentiation-opaque-result-type.swift
./test/AutoDiff/IRGen
./test/AutoDiff/IRGen/loadable_by_address.swift
./test/AutoDiff/IRGen/loadable_by_address_cross_module.swift
./test/AutoDiff/IRGen/witness_table_differentiable_requirements.sil
./test/AutoDiff/IRGen/differentiable_function_type.swift
./test/AutoDiff/IRGen/Inputs
./test/AutoDiff/IRGen/Inputs/loadable_by_address_cross_module.swift
./test/AutoDiff/IRGen/differentiable_function.sil
./test/AutoDiff/Sema
./test/AutoDiff/Sema/DerivedConformances
./test/AutoDiff/Sema/DerivedConformances/class_differentiable.swift
./test/AutoDiff/Sema/DerivedConformances/struct_additive_arithmetic.swift
./test/AutoDiff/Sema/DerivedConformances/struct_differentiable_member_types.swift
./test/AutoDiff/Sema/DerivedConformances/struct_differentiable.swift
./test/AutoDiff/Sema/DerivedConformances/derived_zero_tangent_vector_initializer.swift
./test/AutoDiff/Sema/DerivedConformances/Inputs
./test/AutoDiff/Sema/DerivedConformances/Inputs/struct_differentiable_other_module.swift
./test/AutoDiff/Sema/DerivedConformances/Inputs/class_differentiable_other_module.swift
./test/AutoDiff/Sema/DerivedConformances/Inputs/struct_additive_arithmetic_other_module.swift
./test/AutoDiff/Sema/DerivedConformances/derived_differentiable.swift
./test/AutoDiff/Sema/differentiable_features_disabled.swift
./test/AutoDiff/Sema/DerivativeRegistrationCrossModule
./test/AutoDiff/Sema/DerivativeRegistrationCrossModule/main.swift
./test/AutoDiff/Sema/DerivativeRegistrationCrossModule/Inputs
./test/AutoDiff/Sema/DerivativeRegistrationCrossModule/Inputs/b.swift
./test/AutoDiff/Sema/DerivativeRegistrationCrossModule/Inputs/a.swift
./test/AutoDiff/Sema/missing_differentiable_protocol.swift
./test/AutoDiff/Sema/differentiable_attr_type_checking.swift
./test/AutoDiff/Sema/ExportedDifferentiationModule
./test/AutoDiff/Sema/ExportedDifferentiationModule/main.swift
./test/AutoDiff/Sema/ExportedDifferentiationModule/Inputs
./test/AutoDiff/Sema/ExportedDifferentiationModule/Inputs/exports_differentiation.swift
./test/AutoDiff/Sema/transpose_attr_type_checking.swift
./test/AutoDiff/Sema/differentiable_func_type.swift
./test/AutoDiff/Sema/derivative_attr_type_checking.swift
./test/AutoDiff/TBD
./test/AutoDiff/TBD/derivative_symbols.swift
./test/AutoDiff/compiler_crashers_fixed
./test/AutoDiff/compiler_crashers_fixed/tf1167-differentiable-attr-override-match.swift
./test/AutoDiff/compiler_crashers_fixed/sr12650-noderivative-parameter-type-mangling.swift
./test/AutoDiff/compiler_crashers_fixed/sr12744-unhandled-pullback-indirect-result.swift
./test/AutoDiff/compiler_crashers_fixed/sr12886-sr112887-vjp-emitter-definite-initialization.swift
./test/AutoDiff/compiler_crashers_fixed/tf1160-derivative-usable-from-inline-mismatch.swift
./test/AutoDiff/compiler_crashers_fixed/sr12548-siloptimizer-rewrite-partial-apply-convention-method.swift
./test/AutoDiff/compiler_crashers_fixed/sr12642-differentiable-derivation-redeclared-property.swift
./test/AutoDiff/compiler_crashers_fixed/sr12493-differentiable-function-extract-subst-function-type.swift
./test/AutoDiff/compiler_crashers_fixed/sr12641-silgen-immutable-address-use-verification-failure.swift
./test/AutoDiff/compiler_crashers_fixed/sr12732-optimize-partial-apply-convention-thin-only.swift
./test/AutoDiff/compiler_crashers_fixed/tf1202-differentiability-witness-dead-function-elimination.swift
./test/AutoDiff/compiler_crashers_fixed/tf1232-autodiff-generated-declaration-mangling.swift
./test/AutoDiff/compiler_crashers_fixed/sr12559-derivative-attr-type-checking-parse-stdlib.swift
./test/AutoDiff/compiler_crashers_fixed/Inputs
./test/AutoDiff/compiler_crashers_fixed/Inputs/tf1202-differentiability-witness-dead-function-elimination.swift
./test/AutoDiff/stdlib
./test/AutoDiff/stdlib/collection_higher_order_functions.swift
./test/AutoDiff/stdlib/simd.swift
./test/AutoDiff/stdlib/floating_point.swift.gyb
./test/AutoDiff/stdlib/differentiable_stdlib_conformances.swift
./test/AutoDiff/stdlib/derivative_customization.swift
./test/AutoDiff/stdlib/tgmath_derivatives.swift.gyb
./test/AutoDiff/stdlib/anydifferentiable.swift
./test/AutoDiff/stdlib/differential_operators.swift.gyb
./test/AutoDiff/stdlib/differentiable_protocol.swift
./test/AutoDiff/lit.local.cfg
./test/AutoDiff/SIL
./test/AutoDiff/SIL/differentiable_function_inst.sil
./test/AutoDiff/SIL/differentiability_witness_function_inst.sil
./test/AutoDiff/SIL/differentiability_witness_function_inst_transpose.sil
./test/AutoDiff/SIL/Serialization
./test/AutoDiff/SIL/Serialization/differentiable_function_type.swift
./test/AutoDiff/SIL/Parse
./test/AutoDiff/SIL/Parse/sildeclref.sil
./test/AutoDiff/SIL/linear_function_inst.sil
./test/AutoDiff/SIL/sil_differentiability_witness.sil
./test/AutoDiff/Syntax
./test/AutoDiff/Syntax/round_trip_parse_gen.swift
./test/AutoDiff/Syntax/Outputs
./test/AutoDiff/Syntax/Outputs/round_trip_parse_gen.swift.withkinds
./test/APINotes
./test/APINotes/irgen-prop-getter-setter.swift
./test/APINotes/properties.swift
./test/APINotes/versioned-test-mangling.swift
./test/APINotes/obsoleted.swift
./test/APINotes/versioned.swift
./test/APINotes/versioned-multi.swift
./test/APINotes/broken-swift-name.swift
./test/APINotes/versioned-objc.swift
./test/APINotes/versioned-objc-dynamic-lookup.swift
./test/APINotes/blocks.swift
./test/APINotes/basic.swift
./test/APINotes/type_changes.swift
./test/APINotes/Inputs
./test/APINotes/Inputs/broken-modules
./test/APINotes/Inputs/broken-modules/BrokenAPINotes.h
./test/APINotes/Inputs/broken-modules/module.modulemap
./test/APINotes/Inputs/broken-modules/BrokenAPINotes.apinotes
./test/APINotes/Inputs/custom-frameworks
./test/APINotes/Inputs/custom-frameworks/APINotesFrameworkTest.framework
./test/APINotes/Inputs/custom-frameworks/APINotesFrameworkTest.framework/Headers
./test/APINotes/Inputs/custom-frameworks/APINotesFrameworkTest.framework/Headers/Protocols.h
./test/APINotes/Inputs/custom-frameworks/APINotesFrameworkTest.framework/Headers/APINotesFrameworkTest.h
./test/APINotes/Inputs/custom-frameworks/APINotesFrameworkTest.framework/Headers/Types.h
./test/APINotes/Inputs/custom-frameworks/APINotesFrameworkTest.framework/Headers/Classes.h
./test/APINotes/Inputs/custom-frameworks/APINotesFrameworkTest.framework/Headers/Globals.h
./test/APINotes/Inputs/custom-frameworks/APINotesFrameworkTest.framework/Headers/Enums.h
./test/APINotes/Inputs/custom-frameworks/APINotesFrameworkTest.framework/Headers/SwiftWrapper.h
./test/APINotes/Inputs/custom-frameworks/APINotesFrameworkTest.framework/Headers/ImportAsMember.h
./test/APINotes/Inputs/custom-frameworks/APINotesFrameworkTest.framework/Headers/APINotesFrameworkTest.apinotes
./test/APINotes/Inputs/custom-frameworks/APINotesFrameworkTest.framework/Headers/Properties.h
./test/APINotes/Inputs/custom-frameworks/APINotesFrameworkTest.framework/Modules
./test/APINotes/Inputs/custom-frameworks/APINotesFrameworkTest.framework/Modules/module.modulemap
./test/APINotes/Inputs/custom-modules
./test/APINotes/Inputs/custom-modules/APINotesTest.h
./test/APINotes/Inputs/custom-modules/APINotesTest.apinotes
./test/APINotes/Inputs/custom-modules/module.modulemap
./test/APINotes/Inputs/custom-modules/ObsoletedAPINotesTest.h
./test/APINotes/Inputs/custom-modules/ObsoletedAPINotesTest.apinotes
./test/Driver
./test/Driver/opt-record-options.swift
./test/Driver/bad_exec.swift
./test/Driver/loaded_module_trace_swiftinterface.swift
./test/Driver/batch_mode_parseable_output_cancellation.swift
./test/Driver/options-repl.swift
./test/Driver/options.swift
./test/Driver/opt-remark.swift
./test/Driver/tools_directory.swift
./test/Driver/loaded_module_trace_skip.swift
./test/Driver/swift-version.swift
./test/Driver/debug_anonymous_context_metadata.swift
./test/Driver/autolink-force-load-comdat.swift
./test/Driver/linker-autolink-extract.swift
./test/Driver/negating_WMO.swift
./test/Driver/fuzzer.swift
./test/Driver/modulewrap.swift
./test/Driver/loaded_module_trace_nocrash.swift
./test/Driver/android-sdk.swift
./test/Driver/print_target_info.swift
./test/Driver/basic_output_file_map.swift
./test/Driver/linker.swift
./test/Driver/driver_mode.swift
./test/Driver/batch_mode_remark.swift
./test/Driver/assert.swift
./test/Driver/sdk-version.swift
./test/Driver/emit-interface.swift
./test/Driver/options-repl-darwin.swift
./test/Driver/environment.swift
./test/Driver/linker-arclite.swift
./test/Driver/autolink-force-load-no-comdat.swift
./test/Driver/batch_mode_with_pch.swift
./test/Driver/batch_mode_parseable_output-fine.swift
./test/Driver/batch_mode_with_num-threads.swift
./test/Driver/broken_output_file_map.swift
./test/Driver/loaded_module_trace_env.swift
./test/Driver/color-diagnostics.swift
./test/Driver/batch_mode_bridging_pch.swift
./test/Driver/driver_migration.swift
./test/Driver/emit-sib-single-file.swift
./test/Driver/sdk.swift
./test/Driver/sanitize_recover.swift
./test/Driver/ast_dump_with_WMO.swift
./test/Driver/bindings.swift
./test/Driver/imported_modules.swift
./test/Driver/actions-dsym.swift
./test/Driver/batch_mode_with_supplementary_filelist_unicode.swift
./test/Driver/verify-debug-info.swift
./test/Driver/help.swift
./test/Driver/bridging-pch.swift
./test/Driver/advanced_output_file_map.swift
./test/Driver/debug-prefix-map.swift
./test/Driver/imported_modules_underlying.swift
./test/Driver/loaded_module_trace.swift
./test/Driver/SourceRanges
./test/Driver/SourceRanges/range-incremental-no-build-record.swift
./test/Driver/SourceRanges/Inputs
./test/Driver/SourceRanges/Inputs/range-lifecycle
./test/Driver/SourceRanges/Inputs/range-lifecycle/fileB2-external-change.swift
./test/Driver/SourceRanges/Inputs/range-lifecycle/fileB1-internal-change.swift
./test/Driver/SourceRanges/Inputs/range-lifecycle/output.json
./test/Driver/SourceRanges/Inputs/range-lifecycle/fileB0-baseline.swift
./test/Driver/SourceRanges/Inputs/range-lifecycle/main.swift
./test/Driver/SourceRanges/Inputs/range-lifecycle/fileA.swift
./test/Driver/SourceRanges/Inputs/range-sourcecomparator
./test/Driver/SourceRanges/Inputs/range-sourcecomparator/in1.compiledsource
./test/Driver/SourceRanges/Inputs/range-sourcecomparator/in6.compiledsource
./test/Driver/SourceRanges/Inputs/range-sourcecomparator/in2.swiftranges
./test/Driver/SourceRanges/Inputs/range-sourcecomparator/dummy.swiftdeps
./test/Driver/SourceRanges/Inputs/range-sourcecomparator/in2.compiledsource
./test/Driver/SourceRanges/Inputs/range-sourcecomparator/in4.swiftranges
./test/Driver/SourceRanges/Inputs/range-sourcecomparator/output.json
./test/Driver/SourceRanges/Inputs/range-sourcecomparator/in5.compiledsource
./test/Driver/SourceRanges/Inputs/range-sourcecomparator/in4.compiledsource
./test/Driver/SourceRanges/Inputs/range-sourcecomparator/in1.swiftranges
./test/Driver/SourceRanges/Inputs/range-sourcecomparator/in3.compiledsource
./test/Driver/SourceRanges/Inputs/range-sourcecomparator/in2.swift
./test/Driver/SourceRanges/Inputs/range-sourcecomparator/in6.swiftranges
./test/Driver/SourceRanges/Inputs/range-sourcecomparator/in3.swiftranges
./test/Driver/SourceRanges/Inputs/range-sourcecomparator/in4.swift
./test/Driver/SourceRanges/Inputs/range-sourcecomparator/in6.swift
./test/Driver/SourceRanges/Inputs/range-sourcecomparator/in1.swift
./test/Driver/SourceRanges/Inputs/range-sourcecomparator/in3.swift
./test/Driver/SourceRanges/Inputs/range-sourcecomparator/in5.swiftranges
./test/Driver/SourceRanges/Inputs/range-sourcecomparator/in5.swift
./test/Driver/SourceRanges/Inputs/range-incremental-no-build-record
./test/Driver/SourceRanges/Inputs/range-incremental-no-build-record/output.json
./test/Driver/SourceRanges/Inputs/range-incremental-no-build-record/fileB.swift
./test/Driver/SourceRanges/Inputs/range-incremental-no-build-record/main.swift
./test/Driver/SourceRanges/Inputs/range-incremental-no-build-record/fileA.swift
./test/Driver/emit-dependencies.swift
./test/Driver/Dependencies
./test/Driver/Dependencies/crash-simple-fine.swift
./test/Driver/Dependencies/file-added-fine.swift
./test/Driver/Dependencies/one-way-provides-before-fine.swift
./test/Driver/Dependencies/one-way-merge-module-fine.swift
./test/Driver/Dependencies/one-way-depends-after-fine.swift
./test/Driver/Dependencies/one-way-parseable-fine.swift
./test/Driver/Dependencies/dependencies-preservation-fine.swift
./test/Driver/Dependencies/chained-private-after-fine.swift
./test/Driver/Dependencies/private-after-fine.swift
./test/Driver/Dependencies/malformed-fine.swift
./test/Driver/Dependencies/fail-chained-fine.swift
./test/Driver/Dependencies/driver-show-incremental-mutual-fine.swift
./test/Driver/Dependencies/driver-show-incremental-conflicting-arguments-fine.swift
./test/Driver/Dependencies/check-interface-implementation-fine.swift
./test/Driver/Dependencies/one-way-external-fine.swift
./test/Driver/Dependencies/moduleonly.swift
./test/Driver/Dependencies/crash-added-fine.swift
./test/Driver/Dependencies/independent-parseable-fine.swift
./test/Driver/Dependencies/mutual-fine.swift
./test/Driver/Dependencies/independent-fine.swift
./test/Driver/Dependencies/one-way-fine.swift
./test/Driver/Dependencies/independent-half-dirty-fine.swift
./test/Driver/Dependencies/chained-private-after-multiple-fine.swift
./test/Driver/Dependencies/one-way-while-editing-fine.swift
./test/Driver/Dependencies/chained-private-after-multiple-nominal-members-fine.swift
./test/Driver/Dependencies/chained-private-fine.swift
./test/Driver/Dependencies/driver-show-incremental-inputs-fine.swift
./test/Driver/Dependencies/crash-new-fine.swift
./test/Driver/Dependencies/one-way-depends-before-fine.swift
./test/Driver/Dependencies/chained-fine.swift
./test/Driver/Dependencies/driver-show-incremental-malformed-fine.swift
./test/Driver/Dependencies/mutual-interface-hash-fine.swift
./test/Driver/Dependencies/embed-bitcode-parallel-fine.swift
./test/Driver/Dependencies/whole-module-build-record.swift
./test/Driver/Dependencies/bindings-build-record.swift
./test/Driver/Dependencies/malformed-but-valid-yaml-fine.swift
./test/Driver/Dependencies/one-way-parallel-fine.swift
./test/Driver/Dependencies/chained-additional-kinds-fine.swift
./test/Driver/Dependencies/README.txt
./test/Driver/Dependencies/only-skip-once.swift
./test/Driver/Dependencies/driver-show-incremental-swift-version-fine.swift
./test/Driver/Dependencies/fail-added-fine.swift
./test/Driver/Dependencies/private-fine.swift
./test/Driver/Dependencies/one-way-provides-after-fine.swift
./test/Driver/Dependencies/chained-after-fine.swift
./test/Driver/Dependencies/driver-show-incremental-arguments-fine.swift
./test/Driver/Dependencies/fail-new-fine.swift
./test/Driver/Dependencies/nominal-members-fine.swift
./test/Driver/Dependencies/fail-with-bad-deps-fine.swift
./test/Driver/Dependencies/one-way-external-delete-fine.swift
./test/Driver/Dependencies/fail-interface-hash-fine.swift
./test/Driver/Dependencies/Inputs
./test/Driver/Dependencies/Inputs/chained-private-after-fine
./test/Driver/Dependencies/Inputs/chained-private-after-fine/yet-another.swiftdeps
./test/Driver/Dependencies/Inputs/chained-private-after-fine/output.json
./test/Driver/Dependencies/Inputs/chained-private-after-fine/yet-another.swift
./test/Driver/Dependencies/Inputs/chained-private-after-fine/other.swift
./test/Driver/Dependencies/Inputs/chained-private-after-fine/other.swiftdeps
./test/Driver/Dependencies/Inputs/chained-private-after-fine/main.swift
./test/Driver/Dependencies/Inputs/chained-private-after-fine/main.swiftdeps
./test/Driver/Dependencies/Inputs/moduleonly
./test/Driver/Dependencies/Inputs/moduleonly/output.json
./test/Driver/Dependencies/Inputs/moduleonly/bar.swift
./test/Driver/Dependencies/Inputs/moduleonly/baz.swift
./test/Driver/Dependencies/Inputs/moduleonly/foo.swift
./test/Driver/Dependencies/Inputs/modify-non-primary-files.py
./test/Driver/Dependencies/Inputs/one-way
./test/Driver/Dependencies/Inputs/one-way/output.json
./test/Driver/Dependencies/Inputs/one-way/other.swift
./test/Driver/Dependencies/Inputs/one-way/main.swift
./test/Driver/Dependencies/Inputs/one-way-external-fine
./test/Driver/Dependencies/Inputs/one-way-external-fine/main2-external
./test/Driver/Dependencies/Inputs/one-way-external-fine/other2-external
./test/Driver/Dependencies/Inputs/one-way-external-fine/output.json
./test/Driver/Dependencies/Inputs/one-way-external-fine/other1-external
./test/Driver/Dependencies/Inputs/one-way-external-fine/main1-external
./test/Driver/Dependencies/Inputs/one-way-external-fine/other.swift
./test/Driver/Dependencies/Inputs/one-way-external-fine/main.swift
./test/Driver/Dependencies/Inputs/update-dependencies-bad.py
./test/Driver/Dependencies/Inputs/chained-after-fine
./test/Driver/Dependencies/Inputs/chained-after-fine/yet-another.swiftdeps
./test/Driver/Dependencies/Inputs/chained-after-fine/output.json
./test/Driver/Dependencies/Inputs/chained-after-fine/yet-another.swift
./test/Driver/Dependencies/Inputs/chained-after-fine/other.swift
./test/Driver/Dependencies/Inputs/chained-after-fine/other.swiftdeps
./test/Driver/Dependencies/Inputs/chained-after-fine/main.swift
./test/Driver/Dependencies/Inputs/chained-after-fine/main.swiftdeps
./test/Driver/Dependencies/Inputs/private-fine
./test/Driver/Dependencies/Inputs/private-fine/output.json
./test/Driver/Dependencies/Inputs/private-fine/b.swift
./test/Driver/Dependencies/Inputs/private-fine/d.swift
./test/Driver/Dependencies/Inputs/private-fine/c.swift
./test/Driver/Dependencies/Inputs/private-fine/a.swift
./test/Driver/Dependencies/Inputs/private-fine/e.swift
./test/Driver/Dependencies/Inputs/fail-with-bad-deps-fine
./test/Driver/Dependencies/Inputs/fail-with-bad-deps-fine/output.json
./test/Driver/Dependencies/Inputs/fail-with-bad-deps-fine/bad.swiftdeps
./test/Driver/Dependencies/Inputs/fail-with-bad-deps-fine/depends-on-main.swiftdeps
./test/Driver/Dependencies/Inputs/fail-with-bad-deps-fine/depends-on-bad.swiftdeps
./test/Driver/Dependencies/Inputs/fail-with-bad-deps-fine/depends-on-bad.swift
./test/Driver/Dependencies/Inputs/fail-with-bad-deps-fine/depends-on-main.swift
./test/Driver/Dependencies/Inputs/fail-with-bad-deps-fine/bad.swift
./test/Driver/Dependencies/Inputs/fail-with-bad-deps-fine/main.swift
./test/Driver/Dependencies/Inputs/fail-with-bad-deps-fine/main.swiftdeps
./test/Driver/Dependencies/Inputs/chained-additional-kinds-fine
./test/Driver/Dependencies/Inputs/chained-additional-kinds-fine/output.json
./test/Driver/Dependencies/Inputs/chained-additional-kinds-fine/yet-another.swift
./test/Driver/Dependencies/Inputs/chained-additional-kinds-fine/other.swift
./test/Driver/Dependencies/Inputs/chained-additional-kinds-fine/main.swift
./test/Driver/Dependencies/Inputs/fail-simple-fine
./test/Driver/Dependencies/Inputs/fail-simple-fine/output.json
./test/Driver/Dependencies/Inputs/fail-simple-fine/bad.swift
./test/Driver/Dependencies/Inputs/fail-simple-fine/other.swift
./test/Driver/Dependencies/Inputs/fail-simple-fine/main.swift
./test/Driver/Dependencies/Inputs/chained-private-after-multiple-nominal-members-fine
./test/Driver/Dependencies/Inputs/chained-private-after-multiple-nominal-members-fine/yet-another.swiftdeps
./test/Driver/Dependencies/Inputs/chained-private-after-multiple-nominal-members-fine/output.json
./test/Driver/Dependencies/Inputs/chained-private-after-multiple-nominal-members-fine/yet-another.swift
./test/Driver/Dependencies/Inputs/chained-private-after-multiple-nominal-members-fine/other.swift
./test/Driver/Dependencies/Inputs/chained-private-after-multiple-nominal-members-fine/other.swiftdeps
./test/Driver/Dependencies/Inputs/chained-private-after-multiple-nominal-members-fine/main.swift
./test/Driver/Dependencies/Inputs/chained-private-after-multiple-nominal-members-fine/main.swiftdeps
./test/Driver/Dependencies/Inputs/one-way-with-swiftdeps-fine
./test/Driver/Dependencies/Inputs/one-way-with-swiftdeps-fine/output.json
./test/Driver/Dependencies/Inputs/one-way-with-swiftdeps-fine/other.swift
./test/Driver/Dependencies/Inputs/one-way-with-swiftdeps-fine/other.swiftdeps
./test/Driver/Dependencies/Inputs/one-way-with-swiftdeps-fine/main.swift
./test/Driver/Dependencies/Inputs/one-way-with-swiftdeps-fine/main.swiftdeps
./test/Driver/Dependencies/Inputs/chained-fine
./test/Driver/Dependencies/Inputs/chained-fine/output.json
./test/Driver/Dependencies/Inputs/chained-fine/yet-another.swift
./test/Driver/Dependencies/Inputs/chained-fine/other.swift
./test/Driver/Dependencies/Inputs/chained-fine/main.swift
./test/Driver/Dependencies/Inputs/malformed-but-valid-yaml-fine
./test/Driver/Dependencies/Inputs/malformed-but-valid-yaml-fine/output.json
./test/Driver/Dependencies/Inputs/malformed-but-valid-yaml-fine/other.swift
./test/Driver/Dependencies/Inputs/malformed-but-valid-yaml-fine/other.swiftdeps
./test/Driver/Dependencies/Inputs/malformed-but-valid-yaml-fine/main.swift
./test/Driver/Dependencies/Inputs/malformed-but-valid-yaml-fine/main.swiftdeps
./test/Driver/Dependencies/Inputs/chained-private-after-multiple-fine
./test/Driver/Dependencies/Inputs/chained-private-after-multiple-fine/yet-another.swiftdeps
./test/Driver/Dependencies/Inputs/chained-private-after-multiple-fine/output.json
./test/Driver/Dependencies/Inputs/chained-private-after-multiple-fine/yet-another.swift
./test/Driver/Dependencies/Inputs/chained-private-after-multiple-fine/other.swift
./test/Driver/Dependencies/Inputs/chained-private-after-multiple-fine/other.swiftdeps
./test/Driver/Dependencies/Inputs/chained-private-after-multiple-fine/main.swift
./test/Driver/Dependencies/Inputs/chained-private-after-multiple-fine/main.swiftdeps
./test/Driver/Dependencies/Inputs/fake-build-whole-module.py
./test/Driver/Dependencies/Inputs/private-after-fine
./test/Driver/Dependencies/Inputs/private-after-fine/b.swiftdeps
./test/Driver/Dependencies/Inputs/private-after-fine/d.swiftdeps
./test/Driver/Dependencies/Inputs/private-after-fine/c.swiftdeps
./test/Driver/Dependencies/Inputs/private-after-fine/output.json
./test/Driver/Dependencies/Inputs/private-after-fine/e.swiftdeps
./test/Driver/Dependencies/Inputs/private-after-fine/b.swift
./test/Driver/Dependencies/Inputs/private-after-fine/f.swift
./test/Driver/Dependencies/Inputs/private-after-fine/f.swiftdeps
./test/Driver/Dependencies/Inputs/private-after-fine/d.swift
./test/Driver/Dependencies/Inputs/private-after-fine/c.swift
./test/Driver/Dependencies/Inputs/private-after-fine/a.swift
./test/Driver/Dependencies/Inputs/private-after-fine/a.swiftdeps
./test/Driver/Dependencies/Inputs/private-after-fine/e.swift
./test/Driver/Dependencies/Inputs/private-after-fine/g.swiftdeps
./test/Driver/Dependencies/Inputs/private-after-fine/g.swift
./test/Driver/Dependencies/Inputs/chained
./test/Driver/Dependencies/Inputs/chained/output.json
./test/Driver/Dependencies/Inputs/chained/yet-another.swift
./test/Driver/Dependencies/Inputs/chained/other.swift
./test/Driver/Dependencies/Inputs/chained/main.swift
./test/Driver/Dependencies/Inputs/crash-simple-fine
./test/Driver/Dependencies/Inputs/crash-simple-fine/output.json
./test/Driver/Dependencies/Inputs/crash-simple-fine/crash.swift
./test/Driver/Dependencies/Inputs/crash-simple-fine/other.swift
./test/Driver/Dependencies/Inputs/crash-simple-fine/main.swift
./test/Driver/Dependencies/Inputs/one-way-fine
./test/Driver/Dependencies/Inputs/one-way-fine/output.json
./test/Driver/Dependencies/Inputs/one-way-fine/other.swift
./test/Driver/Dependencies/Inputs/one-way-fine/main.swift
./test/Driver/Dependencies/Inputs/crash-simple-with-swiftdeps
./test/Driver/Dependencies/Inputs/crash-simple-with-swiftdeps/output.json
./test/Driver/Dependencies/Inputs/crash-simple-with-swiftdeps/crash.swift
./test/Driver/Dependencies/Inputs/crash-simple-with-swiftdeps/other.swift
./test/Driver/Dependencies/Inputs/crash-simple-with-swiftdeps/other.swiftdeps
./test/Driver/Dependencies/Inputs/crash-simple-with-swiftdeps/main.swift
./test/Driver/Dependencies/Inputs/crash-simple-with-swiftdeps/main.swiftdeps
./test/Driver/Dependencies/Inputs/crash-simple-with-swiftdeps/crash.swiftdeps
./test/Driver/Dependencies/Inputs/fail-interface-hash-fine
./test/Driver/Dependencies/Inputs/fail-interface-hash-fine/output.json
./test/Driver/Dependencies/Inputs/fail-interface-hash-fine/bad.swiftdeps
./test/Driver/Dependencies/Inputs/fail-interface-hash-fine/depends-on-main.swiftdeps
./test/Driver/Dependencies/Inputs/fail-interface-hash-fine/depends-on-bad.swiftdeps
./test/Driver/Dependencies/Inputs/fail-interface-hash-fine/depends-on-bad.swift
./test/Driver/Dependencies/Inputs/fail-interface-hash-fine/depends-on-main.swift
./test/Driver/Dependencies/Inputs/fail-interface-hash-fine/bad.swift
./test/Driver/Dependencies/Inputs/fail-interface-hash-fine/main.swift
./test/Driver/Dependencies/Inputs/fail-interface-hash-fine/main.swiftdeps
./test/Driver/Dependencies/Inputs/independent-fine
./test/Driver/Dependencies/Inputs/independent-fine/output.json
./test/Driver/Dependencies/Inputs/independent-fine/other.swift
./test/Driver/Dependencies/Inputs/independent-fine/main.swift
./test/Driver/Dependencies/Inputs/crash-simple-with-swiftdeps-fine
./test/Driver/Dependencies/Inputs/crash-simple-with-swiftdeps-fine/output.json
./test/Driver/Dependencies/Inputs/crash-simple-with-swiftdeps-fine/crash.swift
./test/Driver/Dependencies/Inputs/crash-simple-with-swiftdeps-fine/other.swift
./test/Driver/Dependencies/Inputs/crash-simple-with-swiftdeps-fine/other.swiftdeps
./test/Driver/Dependencies/Inputs/crash-simple-with-swiftdeps-fine/main.swift
./test/Driver/Dependencies/Inputs/crash-simple-with-swiftdeps-fine/main.swiftdeps
./test/Driver/Dependencies/Inputs/crash-simple-with-swiftdeps-fine/crash.swiftdeps
./test/Driver/Dependencies/Inputs/one-way-depends-before-fine
./test/Driver/Dependencies/Inputs/one-way-depends-before-fine/output.json
./test/Driver/Dependencies/Inputs/one-way-depends-before-fine/other.swift
./test/Driver/Dependencies/Inputs/one-way-depends-before-fine/other.swiftdeps
./test/Driver/Dependencies/Inputs/one-way-depends-before-fine/main.swift
./test/Driver/Dependencies/Inputs/one-way-depends-before-fine/main.swiftdeps
./test/Driver/Dependencies/Inputs/update-dependencies.py
./test/Driver/Dependencies/Inputs/private
./test/Driver/Dependencies/Inputs/private/output.json
./test/Driver/Dependencies/Inputs/private/b.swift
./test/Driver/Dependencies/Inputs/private/d.swift
./test/Driver/Dependencies/Inputs/private/c.swift
./test/Driver/Dependencies/Inputs/private/a.swift
./test/Driver/Dependencies/Inputs/private/e.swift
./test/Driver/Dependencies/Inputs/one-way-provides-after-fine
./test/Driver/Dependencies/Inputs/one-way-provides-after-fine/output.json
./test/Driver/Dependencies/Inputs/one-way-provides-after-fine/other.swift
./test/Driver/Dependencies/Inputs/one-way-provides-after-fine/other.swiftdeps
./test/Driver/Dependencies/Inputs/one-way-provides-after-fine/main.swift
./test/Driver/Dependencies/Inputs/one-way-provides-after-fine/main.swiftdeps
./test/Driver/Dependencies/Inputs/nominal-members-fine
./test/Driver/Dependencies/Inputs/nominal-members-fine/output.json
./test/Driver/Dependencies/Inputs/nominal-members-fine/a-ext.swift
./test/Driver/Dependencies/Inputs/nominal-members-fine/depends-on-a-foo.swift
./test/Driver/Dependencies/Inputs/nominal-members-fine/depends-on-a-ext.swift
./test/Driver/Dependencies/Inputs/nominal-members-fine/a.swift
./test/Driver/Dependencies/Inputs/one-way-depends-after-fine
./test/Driver/Dependencies/Inputs/one-way-depends-after-fine/output.json
./test/Driver/Dependencies/Inputs/one-way-depends-after-fine/other.swift
./test/Driver/Dependencies/Inputs/one-way-depends-after-fine/other.swiftdeps
./test/Driver/Dependencies/Inputs/one-way-depends-after-fine/main.swift
./test/Driver/Dependencies/Inputs/one-way-depends-after-fine/main.swiftdeps
./test/Driver/Dependencies/Inputs/malformed-after-fine
./test/Driver/Dependencies/Inputs/malformed-after-fine/output.json
./test/Driver/Dependencies/Inputs/malformed-after-fine/other.swift
./test/Driver/Dependencies/Inputs/malformed-after-fine/other.swiftdeps
./test/Driver/Dependencies/Inputs/malformed-after-fine/main.swift
./test/Driver/Dependencies/Inputs/malformed-after-fine/main.swiftdeps
./test/Driver/Dependencies/Inputs/chained-private-fine
./test/Driver/Dependencies/Inputs/chained-private-fine/output.json
./test/Driver/Dependencies/Inputs/chained-private-fine/yet-another.swift
./test/Driver/Dependencies/Inputs/chained-private-fine/other.swift
./test/Driver/Dependencies/Inputs/chained-private-fine/main.swift
./test/Driver/Dependencies/Inputs/mutual-with-swiftdeps-fine
./test/Driver/Dependencies/Inputs/mutual-with-swiftdeps-fine/output.json
./test/Driver/Dependencies/Inputs/mutual-with-swiftdeps-fine/other.swift
./test/Driver/Dependencies/Inputs/mutual-with-swiftdeps-fine/other.swiftdeps
./test/Driver/Dependencies/Inputs/mutual-with-swiftdeps-fine/main.swift
./test/Driver/Dependencies/Inputs/mutual-with-swiftdeps-fine/main.swiftdeps
./test/Driver/Dependencies/Inputs/touch.py
./test/Driver/Dependencies/Inputs/mutual-interface-hash-fine
./test/Driver/Dependencies/Inputs/mutual-interface-hash-fine/does-change.swift
./test/Driver/Dependencies/Inputs/mutual-interface-hash-fine/output.json
./test/Driver/Dependencies/Inputs/mutual-interface-hash-fine/does-not-change.swift
./test/Driver/Dependencies/Inputs/mutual-interface-hash-fine/does-not-change.swiftdeps
./test/Driver/Dependencies/Inputs/mutual-interface-hash-fine/does-change.swiftdeps
./test/Driver/Dependencies/Inputs/fail-chained-fine
./test/Driver/Dependencies/Inputs/fail-chained-fine/output.json
./test/Driver/Dependencies/Inputs/fail-chained-fine/b.swift
./test/Driver/Dependencies/Inputs/fail-chained-fine/f.swift
./test/Driver/Dependencies/Inputs/fail-chained-fine/d.swift
./test/Driver/Dependencies/Inputs/fail-chained-fine/bad.swift
./test/Driver/Dependencies/Inputs/fail-chained-fine/c.swift
./test/Driver/Dependencies/Inputs/fail-chained-fine/a.swift
./test/Driver/Dependencies/Inputs/fail-chained-fine/e.swift
./test/Driver/Dependencies/Inputs/check-interface-implementation-fine
./test/Driver/Dependencies/Inputs/check-interface-implementation-fine/output.json
./test/Driver/Dependencies/Inputs/check-interface-implementation-fine/bad.swift
./test/Driver/Dependencies/Inputs/check-interface-implementation-fine/c.swift
./test/Driver/Dependencies/Inputs/check-interface-implementation-fine/a.swift
./test/Driver/Dependencies/Inputs/bindings-build-record
./test/Driver/Dependencies/Inputs/bindings-build-record/main.o
./test/Driver/Dependencies/Inputs/bindings-build-record/other.o
./test/Driver/Dependencies/Inputs/bindings-build-record/output.json
./test/Driver/Dependencies/Inputs/bindings-build-record/yet-another.swift
./test/Driver/Dependencies/Inputs/bindings-build-record/added.swift
./test/Driver/Dependencies/Inputs/bindings-build-record/other.swift
./test/Driver/Dependencies/Inputs/bindings-build-record/yet-another.o
./test/Driver/Dependencies/Inputs/bindings-build-record/main.swift
./test/Driver/Dependencies/Inputs/one-way-provides-before-fine
./test/Driver/Dependencies/Inputs/one-way-provides-before-fine/output.json
./test/Driver/Dependencies/Inputs/one-way-provides-before-fine/other.swift
./test/Driver/Dependencies/Inputs/one-way-provides-before-fine/other.swiftdeps
./test/Driver/Dependencies/Inputs/one-way-provides-before-fine/main.swift
./test/Driver/Dependencies/Inputs/one-way-provides-before-fine/main.swiftdeps
./test/Driver/Dependencies/Inputs/only-skip-once
./test/Driver/Dependencies/Inputs/only-skip-once/file2.swift
./test/Driver/Dependencies/Inputs/only-skip-once/file1.swift
./test/Driver/Dependencies/Inputs/only-skip-once/output-file-map.json
./test/Driver/Dependencies/Inputs/only-skip-once/main.swift
./test/Driver/Dependencies/Inputs/fake-build-for-bitcode.py
./test/Driver/Dependencies/Inputs/mutual-fine
./test/Driver/Dependencies/Inputs/mutual-fine/output.json
./test/Driver/Dependencies/Inputs/mutual-fine/other.swift
./test/Driver/Dependencies/Inputs/mutual-fine/main.swift
./test/Driver/Dependencies/fail-simple-fine.swift
./test/Driver/print_target_info_macos.swift
./test/Driver/multi-threaded.swift
./test/Driver/emit-objc-header-single-vs-multi-file.swift
./test/Driver/temp-files.swift
./test/Driver/pipe_round_robin.swift.gyb
./test/Driver/infer-simulator.swift
./test/Driver/batch_mode_print_jobs.swift
./test/Driver/createCompilerInvocation.swift
./test/Driver/sourceinfo_file.swift
./test/Driver/static-archive.swift
./test/Driver/parseable_output.swift
./test/Driver/filelist-threshold.swift
./test/Driver/batch_mode_response_files.swift
./test/Driver/loaded_module_trace_append.swift
./test/Driver/swift-version-default.swift
./test/Driver/PrivateDependencies
./test/Driver/PrivateDependencies/crash-simple-fine.swift
./test/Driver/PrivateDependencies/file-added-fine.swift
./test/Driver/PrivateDependencies/one-way-provides-before-fine.swift
./test/Driver/PrivateDependencies/one-way-merge-module-fine.swift
./test/Driver/PrivateDependencies/one-way-depends-after-fine.swift
./test/Driver/PrivateDependencies/one-way-parseable-fine.swift
./test/Driver/PrivateDependencies/dependencies-preservation-fine.swift
./test/Driver/PrivateDependencies/chained-private-after-fine.swift
./test/Driver/PrivateDependencies/private-after-fine.swift
./test/Driver/PrivateDependencies/malformed-fine.swift
./test/Driver/PrivateDependencies/fail-chained-fine.swift
./test/Driver/PrivateDependencies/driver-show-incremental-mutual-fine.swift
./test/Driver/PrivateDependencies/driver-show-incremental-conflicting-arguments-fine.swift
./test/Driver/PrivateDependencies/check-interface-implementation-fine.swift
./test/Driver/PrivateDependencies/one-way-external-fine.swift
./test/Driver/PrivateDependencies/moduleonly.swift
./test/Driver/PrivateDependencies/crash-added-fine.swift
./test/Driver/PrivateDependencies/independent-parseable-fine.swift
./test/Driver/PrivateDependencies/mutual-fine.swift
./test/Driver/PrivateDependencies/independent-fine.swift
./test/Driver/PrivateDependencies/one-way-fine.swift
./test/Driver/PrivateDependencies/independent-half-dirty-fine.swift
./test/Driver/PrivateDependencies/chained-private-after-multiple-fine.swift
./test/Driver/PrivateDependencies/one-way-while-editing-fine.swift
./test/Driver/PrivateDependencies/chained-private-after-multiple-nominal-members-fine.swift
./test/Driver/PrivateDependencies/chained-private-fine.swift
./test/Driver/PrivateDependencies/driver-show-incremental-inputs-fine.swift
./test/Driver/PrivateDependencies/crash-new-fine.swift
./test/Driver/PrivateDependencies/one-way-depends-before-fine.swift
./test/Driver/PrivateDependencies/chained-fine.swift
./test/Driver/PrivateDependencies/driver-show-incremental-malformed-fine.swift
./test/Driver/PrivateDependencies/mutual-interface-hash-fine.swift
./test/Driver/PrivateDependencies/embed-bitcode-parallel-fine.swift
./test/Driver/PrivateDependencies/whole-module-build-record.swift
./test/Driver/PrivateDependencies/bindings-build-record.swift
./test/Driver/PrivateDependencies/malformed-but-valid-yaml-fine.swift
./test/Driver/PrivateDependencies/one-way-parallel-fine.swift
./test/Driver/PrivateDependencies/chained-additional-kinds-fine.swift
./test/Driver/PrivateDependencies/README.txt
./test/Driver/PrivateDependencies/only-skip-once.swift
./test/Driver/PrivateDependencies/driver-show-incremental-swift-version-fine.swift
./test/Driver/PrivateDependencies/fail-added-fine.swift
./test/Driver/PrivateDependencies/private-fine.swift
./test/Driver/PrivateDependencies/one-way-provides-after-fine.swift
./test/Driver/PrivateDependencies/chained-after-fine.swift
./test/Driver/PrivateDependencies/driver-show-incremental-arguments-fine.swift
./test/Driver/PrivateDependencies/fail-new-fine.swift
./test/Driver/PrivateDependencies/nominal-members-fine.swift
./test/Driver/PrivateDependencies/fail-with-bad-deps-fine.swift
./test/Driver/PrivateDependencies/one-way-external-delete-fine.swift
./test/Driver/PrivateDependencies/fail-interface-hash-fine.swift
./test/Driver/PrivateDependencies/Inputs
./test/Driver/PrivateDependencies/Inputs/chained-private-after-fine
./test/Driver/PrivateDependencies/Inputs/chained-private-after-fine/yet-another.swiftdeps
./test/Driver/PrivateDependencies/Inputs/chained-private-after-fine/output.json
./test/Driver/PrivateDependencies/Inputs/chained-private-after-fine/yet-another.swift
./test/Driver/PrivateDependencies/Inputs/chained-private-after-fine/other.swift
./test/Driver/PrivateDependencies/Inputs/chained-private-after-fine/other.swiftdeps
./test/Driver/PrivateDependencies/Inputs/chained-private-after-fine/main.swift
./test/Driver/PrivateDependencies/Inputs/chained-private-after-fine/main.swiftdeps
./test/Driver/PrivateDependencies/Inputs/moduleonly
./test/Driver/PrivateDependencies/Inputs/moduleonly/output.json
./test/Driver/PrivateDependencies/Inputs/moduleonly/bar.swift
./test/Driver/PrivateDependencies/Inputs/moduleonly/baz.swift
./test/Driver/PrivateDependencies/Inputs/moduleonly/foo.swift
./test/Driver/PrivateDependencies/Inputs/modify-non-primary-files.py
./test/Driver/PrivateDependencies/Inputs/one-way
./test/Driver/PrivateDependencies/Inputs/one-way/output.json
./test/Driver/PrivateDependencies/Inputs/one-way/other.swift
./test/Driver/PrivateDependencies/Inputs/one-way/main.swift
./test/Driver/PrivateDependencies/Inputs/one-way-external-fine
./test/Driver/PrivateDependencies/Inputs/one-way-external-fine/main2-external
./test/Driver/PrivateDependencies/Inputs/one-way-external-fine/other2-external
./test/Driver/PrivateDependencies/Inputs/one-way-external-fine/output.json
./test/Driver/PrivateDependencies/Inputs/one-way-external-fine/other1-external
./test/Driver/PrivateDependencies/Inputs/one-way-external-fine/main1-external
./test/Driver/PrivateDependencies/Inputs/one-way-external-fine/other.swift
./test/Driver/PrivateDependencies/Inputs/one-way-external-fine/main.swift
./test/Driver/PrivateDependencies/Inputs/update-dependencies-bad.py
./test/Driver/PrivateDependencies/Inputs/chained-after-fine
./test/Driver/PrivateDependencies/Inputs/chained-after-fine/yet-another.swiftdeps
./test/Driver/PrivateDependencies/Inputs/chained-after-fine/output.json
./test/Driver/PrivateDependencies/Inputs/chained-after-fine/yet-another.swift
./test/Driver/PrivateDependencies/Inputs/chained-after-fine/other.swift
./test/Driver/PrivateDependencies/Inputs/chained-after-fine/other.swiftdeps
./test/Driver/PrivateDependencies/Inputs/chained-after-fine/main.swift
./test/Driver/PrivateDependencies/Inputs/chained-after-fine/main.swiftdeps
./test/Driver/PrivateDependencies/Inputs/private-fine
./test/Driver/PrivateDependencies/Inputs/private-fine/output.json
./test/Driver/PrivateDependencies/Inputs/private-fine/b.swift
./test/Driver/PrivateDependencies/Inputs/private-fine/d.swift
./test/Driver/PrivateDependencies/Inputs/private-fine/c.swift
./test/Driver/PrivateDependencies/Inputs/private-fine/a.swift
./test/Driver/PrivateDependencies/Inputs/private-fine/e.swift
./test/Driver/PrivateDependencies/Inputs/fail-with-bad-deps-fine
./test/Driver/PrivateDependencies/Inputs/fail-with-bad-deps-fine/output.json
./test/Driver/PrivateDependencies/Inputs/fail-with-bad-deps-fine/bad.swiftdeps
./test/Driver/PrivateDependencies/Inputs/fail-with-bad-deps-fine/depends-on-main.swiftdeps
./test/Driver/PrivateDependencies/Inputs/fail-with-bad-deps-fine/depends-on-bad.swiftdeps
./test/Driver/PrivateDependencies/Inputs/fail-with-bad-deps-fine/depends-on-bad.swift
./test/Driver/PrivateDependencies/Inputs/fail-with-bad-deps-fine/depends-on-main.swift
./test/Driver/PrivateDependencies/Inputs/fail-with-bad-deps-fine/bad.swift
./test/Driver/PrivateDependencies/Inputs/fail-with-bad-deps-fine/main.swift
./test/Driver/PrivateDependencies/Inputs/fail-with-bad-deps-fine/main.swiftdeps
./test/Driver/PrivateDependencies/Inputs/chained-additional-kinds-fine
./test/Driver/PrivateDependencies/Inputs/chained-additional-kinds-fine/output.json
./test/Driver/PrivateDependencies/Inputs/chained-additional-kinds-fine/yet-another.swift
./test/Driver/PrivateDependencies/Inputs/chained-additional-kinds-fine/other.swift
./test/Driver/PrivateDependencies/Inputs/chained-additional-kinds-fine/main.swift
./test/Driver/PrivateDependencies/Inputs/fail-simple-fine
./test/Driver/PrivateDependencies/Inputs/fail-simple-fine/output.json
./test/Driver/PrivateDependencies/Inputs/fail-simple-fine/bad.swift
./test/Driver/PrivateDependencies/Inputs/fail-simple-fine/other.swift
./test/Driver/PrivateDependencies/Inputs/fail-simple-fine/main.swift
./test/Driver/PrivateDependencies/Inputs/chained-private-after-multiple-nominal-members-fine
./test/Driver/PrivateDependencies/Inputs/chained-private-after-multiple-nominal-members-fine/yet-another.swiftdeps
./test/Driver/PrivateDependencies/Inputs/chained-private-after-multiple-nominal-members-fine/output.json
./test/Driver/PrivateDependencies/Inputs/chained-private-after-multiple-nominal-members-fine/yet-another.swift
./test/Driver/PrivateDependencies/Inputs/chained-private-after-multiple-nominal-members-fine/other.swift
./test/Driver/PrivateDependencies/Inputs/chained-private-after-multiple-nominal-members-fine/other.swiftdeps
./test/Driver/PrivateDependencies/Inputs/chained-private-after-multiple-nominal-members-fine/main.swift
./test/Driver/PrivateDependencies/Inputs/chained-private-after-multiple-nominal-members-fine/main.swiftdeps
./test/Driver/PrivateDependencies/Inputs/one-way-with-swiftdeps-fine
./test/Driver/PrivateDependencies/Inputs/one-way-with-swiftdeps-fine/output.json
./test/Driver/PrivateDependencies/Inputs/one-way-with-swiftdeps-fine/other.swift
./test/Driver/PrivateDependencies/Inputs/one-way-with-swiftdeps-fine/other.swiftdeps
./test/Driver/PrivateDependencies/Inputs/one-way-with-swiftdeps-fine/main.swift
./test/Driver/PrivateDependencies/Inputs/one-way-with-swiftdeps-fine/main.swiftdeps
./test/Driver/PrivateDependencies/Inputs/chained-fine
./test/Driver/PrivateDependencies/Inputs/chained-fine/output.json
./test/Driver/PrivateDependencies/Inputs/chained-fine/yet-another.swift
./test/Driver/PrivateDependencies/Inputs/chained-fine/other.swift
./test/Driver/PrivateDependencies/Inputs/chained-fine/main.swift
./test/Driver/PrivateDependencies/Inputs/malformed-but-valid-yaml-fine
./test/Driver/PrivateDependencies/Inputs/malformed-but-valid-yaml-fine/output.json
./test/Driver/PrivateDependencies/Inputs/malformed-but-valid-yaml-fine/other.swift
./test/Driver/PrivateDependencies/Inputs/malformed-but-valid-yaml-fine/other.swiftdeps
./test/Driver/PrivateDependencies/Inputs/malformed-but-valid-yaml-fine/main.swift
./test/Driver/PrivateDependencies/Inputs/malformed-but-valid-yaml-fine/main.swiftdeps
./test/Driver/PrivateDependencies/Inputs/chained-private-after-multiple-fine
./test/Driver/PrivateDependencies/Inputs/chained-private-after-multiple-fine/yet-another.swiftdeps
./test/Driver/PrivateDependencies/Inputs/chained-private-after-multiple-fine/output.json
./test/Driver/PrivateDependencies/Inputs/chained-private-after-multiple-fine/yet-another.swift
./test/Driver/PrivateDependencies/Inputs/chained-private-after-multiple-fine/other.swift
./test/Driver/PrivateDependencies/Inputs/chained-private-after-multiple-fine/other.swiftdeps
./test/Driver/PrivateDependencies/Inputs/chained-private-after-multiple-fine/main.swift
./test/Driver/PrivateDependencies/Inputs/chained-private-after-multiple-fine/main.swiftdeps
./test/Driver/PrivateDependencies/Inputs/fake-build-whole-module.py
./test/Driver/PrivateDependencies/Inputs/private-after-fine
./test/Driver/PrivateDependencies/Inputs/private-after-fine/b.swiftdeps
./test/Driver/PrivateDependencies/Inputs/private-after-fine/d.swiftdeps
./test/Driver/PrivateDependencies/Inputs/private-after-fine/c.swiftdeps
./test/Driver/PrivateDependencies/Inputs/private-after-fine/output.json
./test/Driver/PrivateDependencies/Inputs/private-after-fine/e.swiftdeps
./test/Driver/PrivateDependencies/Inputs/private-after-fine/b.swift
./test/Driver/PrivateDependencies/Inputs/private-after-fine/f.swift
./test/Driver/PrivateDependencies/Inputs/private-after-fine/f.swiftdeps
./test/Driver/PrivateDependencies/Inputs/private-after-fine/d.swift
./test/Driver/PrivateDependencies/Inputs/private-after-fine/c.swift
./test/Driver/PrivateDependencies/Inputs/private-after-fine/a.swift
./test/Driver/PrivateDependencies/Inputs/private-after-fine/a.swiftdeps
./test/Driver/PrivateDependencies/Inputs/private-after-fine/e.swift
./test/Driver/PrivateDependencies/Inputs/private-after-fine/g.swiftdeps
./test/Driver/PrivateDependencies/Inputs/private-after-fine/g.swift
./test/Driver/PrivateDependencies/Inputs/chained
./test/Driver/PrivateDependencies/Inputs/chained/output.json
./test/Driver/PrivateDependencies/Inputs/chained/yet-another.swift
./test/Driver/PrivateDependencies/Inputs/chained/other.swift
./test/Driver/PrivateDependencies/Inputs/chained/main.swift
./test/Driver/PrivateDependencies/Inputs/crash-simple-fine
./test/Driver/PrivateDependencies/Inputs/crash-simple-fine/output.json
./test/Driver/PrivateDependencies/Inputs/crash-simple-fine/crash.swift
./test/Driver/PrivateDependencies/Inputs/crash-simple-fine/other.swift
./test/Driver/PrivateDependencies/Inputs/crash-simple-fine/main.swift
./test/Driver/PrivateDependencies/Inputs/one-way-fine
./test/Driver/PrivateDependencies/Inputs/one-way-fine/output.json
./test/Driver/PrivateDependencies/Inputs/one-way-fine/other.swift
./test/Driver/PrivateDependencies/Inputs/one-way-fine/main.swift
./test/Driver/PrivateDependencies/Inputs/fail-interface-hash-fine
./test/Driver/PrivateDependencies/Inputs/fail-interface-hash-fine/output.json
./test/Driver/PrivateDependencies/Inputs/fail-interface-hash-fine/bad.swiftdeps
./test/Driver/PrivateDependencies/Inputs/fail-interface-hash-fine/depends-on-main.swiftdeps
./test/Driver/PrivateDependencies/Inputs/fail-interface-hash-fine/depends-on-bad.swiftdeps
./test/Driver/PrivateDependencies/Inputs/fail-interface-hash-fine/depends-on-bad.swift
./test/Driver/PrivateDependencies/Inputs/fail-interface-hash-fine/depends-on-main.swift
./test/Driver/PrivateDependencies/Inputs/fail-interface-hash-fine/bad.swift
./test/Driver/PrivateDependencies/Inputs/fail-interface-hash-fine/main.swift
./test/Driver/PrivateDependencies/Inputs/fail-interface-hash-fine/main.swiftdeps
./test/Driver/PrivateDependencies/Inputs/independent-fine
./test/Driver/PrivateDependencies/Inputs/independent-fine/output.json
./test/Driver/PrivateDependencies/Inputs/independent-fine/other.swift
./test/Driver/PrivateDependencies/Inputs/independent-fine/main.swift
./test/Driver/PrivateDependencies/Inputs/crash-simple-with-swiftdeps-fine
./test/Driver/PrivateDependencies/Inputs/crash-simple-with-swiftdeps-fine/output.json
./test/Driver/PrivateDependencies/Inputs/crash-simple-with-swiftdeps-fine/crash.swift
./test/Driver/PrivateDependencies/Inputs/crash-simple-with-swiftdeps-fine/other.swift
./test/Driver/PrivateDependencies/Inputs/crash-simple-with-swiftdeps-fine/other.swiftdeps
./test/Driver/PrivateDependencies/Inputs/crash-simple-with-swiftdeps-fine/main.swift
./test/Driver/PrivateDependencies/Inputs/crash-simple-with-swiftdeps-fine/main.swiftdeps
./test/Driver/PrivateDependencies/Inputs/crash-simple-with-swiftdeps-fine/crash.swiftdeps
./test/Driver/PrivateDependencies/Inputs/one-way-depends-before-fine
./test/Driver/PrivateDependencies/Inputs/one-way-depends-before-fine/output.json
./test/Driver/PrivateDependencies/Inputs/one-way-depends-before-fine/other.swift
./test/Driver/PrivateDependencies/Inputs/one-way-depends-before-fine/other.swiftdeps
./test/Driver/PrivateDependencies/Inputs/one-way-depends-before-fine/main.swift
./test/Driver/PrivateDependencies/Inputs/one-way-depends-before-fine/main.swiftdeps
./test/Driver/PrivateDependencies/Inputs/update-dependencies.py
./test/Driver/PrivateDependencies/Inputs/private
./test/Driver/PrivateDependencies/Inputs/private/output.json
./test/Driver/PrivateDependencies/Inputs/private/b.swift
./test/Driver/PrivateDependencies/Inputs/private/d.swift
./test/Driver/PrivateDependencies/Inputs/private/c.swift
./test/Driver/PrivateDependencies/Inputs/private/a.swift
./test/Driver/PrivateDependencies/Inputs/private/e.swift
./test/Driver/PrivateDependencies/Inputs/one-way-provides-after-fine
./test/Driver/PrivateDependencies/Inputs/one-way-provides-after-fine/output.json
./test/Driver/PrivateDependencies/Inputs/one-way-provides-after-fine/other.swift
./test/Driver/PrivateDependencies/Inputs/one-way-provides-after-fine/other.swiftdeps
./test/Driver/PrivateDependencies/Inputs/one-way-provides-after-fine/main.swift
./test/Driver/PrivateDependencies/Inputs/one-way-provides-after-fine/main.swiftdeps
./test/Driver/PrivateDependencies/Inputs/nominal-members-fine
./test/Driver/PrivateDependencies/Inputs/nominal-members-fine/output.json
./test/Driver/PrivateDependencies/Inputs/nominal-members-fine/a-ext.swift
./test/Driver/PrivateDependencies/Inputs/nominal-members-fine/depends-on-a-foo.swift
./test/Driver/PrivateDependencies/Inputs/nominal-members-fine/depends-on-a-ext.swift
./test/Driver/PrivateDependencies/Inputs/nominal-members-fine/a.swift
./test/Driver/PrivateDependencies/Inputs/one-way-depends-after-fine
./test/Driver/PrivateDependencies/Inputs/one-way-depends-after-fine/output.json
./test/Driver/PrivateDependencies/Inputs/one-way-depends-after-fine/other.swift
./test/Driver/PrivateDependencies/Inputs/one-way-depends-after-fine/other.swiftdeps
./test/Driver/PrivateDependencies/Inputs/one-way-depends-after-fine/main.swift
./test/Driver/PrivateDependencies/Inputs/one-way-depends-after-fine/main.swiftdeps
./test/Driver/PrivateDependencies/Inputs/malformed-after-fine
./test/Driver/PrivateDependencies/Inputs/malformed-after-fine/output.json
./test/Driver/PrivateDependencies/Inputs/malformed-after-fine/other.swift
./test/Driver/PrivateDependencies/Inputs/malformed-after-fine/other.swiftdeps
./test/Driver/PrivateDependencies/Inputs/malformed-after-fine/main.swift
./test/Driver/PrivateDependencies/Inputs/malformed-after-fine/main.swiftdeps
./test/Driver/PrivateDependencies/Inputs/chained-private-fine
./test/Driver/PrivateDependencies/Inputs/chained-private-fine/output.json
./test/Driver/PrivateDependencies/Inputs/chained-private-fine/yet-another.swift
./test/Driver/PrivateDependencies/Inputs/chained-private-fine/other.swift
./test/Driver/PrivateDependencies/Inputs/chained-private-fine/main.swift
./test/Driver/PrivateDependencies/Inputs/mutual-with-swiftdeps-fine
./test/Driver/PrivateDependencies/Inputs/mutual-with-swiftdeps-fine/output.json
./test/Driver/PrivateDependencies/Inputs/mutual-with-swiftdeps-fine/other.swift
./test/Driver/PrivateDependencies/Inputs/mutual-with-swiftdeps-fine/other.swiftdeps
./test/Driver/PrivateDependencies/Inputs/mutual-with-swiftdeps-fine/main.swift
./test/Driver/PrivateDependencies/Inputs/mutual-with-swiftdeps-fine/main.swiftdeps
./test/Driver/PrivateDependencies/Inputs/touch.py
./test/Driver/PrivateDependencies/Inputs/mutual-interface-hash-fine
./test/Driver/PrivateDependencies/Inputs/mutual-interface-hash-fine/does-change.swift
./test/Driver/PrivateDependencies/Inputs/mutual-interface-hash-fine/output.json
./test/Driver/PrivateDependencies/Inputs/mutual-interface-hash-fine/does-not-change.swift
./test/Driver/PrivateDependencies/Inputs/mutual-interface-hash-fine/does-not-change.swiftdeps
./test/Driver/PrivateDependencies/Inputs/mutual-interface-hash-fine/does-change.swiftdeps
./test/Driver/PrivateDependencies/Inputs/fail-chained-fine
./test/Driver/PrivateDependencies/Inputs/fail-chained-fine/output.json
./test/Driver/PrivateDependencies/Inputs/fail-chained-fine/b.swift
./test/Driver/PrivateDependencies/Inputs/fail-chained-fine/f.swift
./test/Driver/PrivateDependencies/Inputs/fail-chained-fine/d.swift
./test/Driver/PrivateDependencies/Inputs/fail-chained-fine/bad.swift
./test/Driver/PrivateDependencies/Inputs/fail-chained-fine/c.swift
./test/Driver/PrivateDependencies/Inputs/fail-chained-fine/a.swift
./test/Driver/PrivateDependencies/Inputs/fail-chained-fine/e.swift
./test/Driver/PrivateDependencies/Inputs/check-interface-implementation-fine
./test/Driver/PrivateDependencies/Inputs/check-interface-implementation-fine/output.json
./test/Driver/PrivateDependencies/Inputs/check-interface-implementation-fine/bad.swift
./test/Driver/PrivateDependencies/Inputs/check-interface-implementation-fine/c.swift
./test/Driver/PrivateDependencies/Inputs/check-interface-implementation-fine/a.swift
./test/Driver/PrivateDependencies/Inputs/bindings-build-record
./test/Driver/PrivateDependencies/Inputs/bindings-build-record/main.o
./test/Driver/PrivateDependencies/Inputs/bindings-build-record/other.o
./test/Driver/PrivateDependencies/Inputs/bindings-build-record/output.json
./test/Driver/PrivateDependencies/Inputs/bindings-build-record/yet-another.swift
./test/Driver/PrivateDependencies/Inputs/bindings-build-record/added.swift
./test/Driver/PrivateDependencies/Inputs/bindings-build-record/other.swift
./test/Driver/PrivateDependencies/Inputs/bindings-build-record/yet-another.o
./test/Driver/PrivateDependencies/Inputs/bindings-build-record/main.swift
./test/Driver/PrivateDependencies/Inputs/one-way-provides-before-fine
./test/Driver/PrivateDependencies/Inputs/one-way-provides-before-fine/output.json
./test/Driver/PrivateDependencies/Inputs/one-way-provides-before-fine/other.swift
./test/Driver/PrivateDependencies/Inputs/one-way-provides-before-fine/other.swiftdeps
./test/Driver/PrivateDependencies/Inputs/one-way-provides-before-fine/main.swift
./test/Driver/PrivateDependencies/Inputs/one-way-provides-before-fine/main.swiftdeps
./test/Driver/PrivateDependencies/Inputs/only-skip-once
./test/Driver/PrivateDependencies/Inputs/only-skip-once/file2.swift
./test/Driver/PrivateDependencies/Inputs/only-skip-once/file1.swift
./test/Driver/PrivateDependencies/Inputs/only-skip-once/output-file-map.json
./test/Driver/PrivateDependencies/Inputs/only-skip-once/main.swift
./test/Driver/PrivateDependencies/Inputs/fake-build-for-bitcode.py
./test/Driver/PrivateDependencies/Inputs/mutual-fine
./test/Driver/PrivateDependencies/Inputs/mutual-fine/output.json
./test/Driver/PrivateDependencies/Inputs/mutual-fine/other.swift
./test/Driver/PrivateDependencies/Inputs/mutual-fine/main.swift
./test/Driver/PrivateDependencies/fail-simple-fine.swift
./test/Driver/linker-rpath.swift
./test/Driver/crash.swift
./test/Driver/subcommands.swift
./test/Driver/coverage-prefix-map.swift
./test/Driver/missing-ofm.swift
./test/Driver/loaded_module_trace_multifile.swift
./test/Driver/merge-module.swift
./test/Driver/imported_modules_bridging_header.swift
./test/Driver/android-link.swift
./test/Driver/sanitize_scudo.swift
./test/Driver/force-response-files.swift
./test/Driver/linker-args-order-linux.swift
./test/Driver/parseable_output_unicode.swift
./test/Driver/loaded_module_trace_header.swift
./test/Driver/sdk-link.swift
./test/Driver/batch_mode_with_supplementary_filelist.swift
./test/Driver/autolink-no-shared-objects-elf.swift
./test/Driver/batch_mode_with_supplementary_filelist_execution.swift
./test/Driver/response-file.swift
./test/Driver/macabi-environment.swift
./test/Driver/unknown-inputs.swift
./test/Driver/no-inputs.swift
./test/Driver/filelists.swift
./test/Driver/sdk-apple.swift
./test/Driver/batch_mode_dependencies_make_wrong_order.swift
./test/Driver/options-interpreter.swift
./test/Driver/sanitize_coverage.swift
./test/Driver/emit-module-from-sib.swift
./test/Driver/driver-time-compilation.swift
./test/Driver/vfs.swift
./test/Driver/embed-bitcode.swift
./test/Driver/working-directory.swift
./test/Driver/opt-record-bitstream.swift
./test/Driver/warnings-control.swift
./test/Driver/os-deployment.swift
./test/Driver/supplementary-filelist-empty.swift
./test/Driver/linker-clang_rt.swift
./test/Driver/bad_tmpdir.swift
./test/Driver/loaded_module_trace_foundation.swift
./test/Driver/static-executable.swift
./test/Driver/driver-compile.swift
./test/Driver/profiling.swift
./test/Driver/autolink_extract.swift
./test/Driver/emit-objc-header.swift
./test/Driver/verbose.swift
./test/Driver/warn_swift3_objc_inference.swift
./test/Driver/batch_mode.swift
./test/Driver/emit-sil-single-file.swift
./test/Driver/response-file-merge-modules.swift
./test/Driver/actions.swift
./test/Driver/batch_mode_aux_file_order.swift
./test/Driver/opt-record.swift
./test/Driver/Inputs
./test/Driver/Inputs/loaded_module_trace_header2.h
./test/Driver/Inputs/lib.swift
./test/Driver/Inputs/xcrun-bad.sh
./test/Driver/Inputs/loaded_module_trace_imports_module.swift
./test/Driver/Inputs/crash.py
./test/Driver/Inputs/fake-resource-dir
./test/Driver/Inputs/fake-resource-dir/lib
./test/Driver/Inputs/fake-resource-dir/lib/swift
./test/Driver/Inputs/fake-resource-dir/lib/swift/clang
./test/Driver/Inputs/fake-resource-dir/lib/swift/clang/lib
./test/Driver/Inputs/fake-resource-dir/lib/swift/clang/lib/linux
./test/Driver/Inputs/fake-resource-dir/lib/swift/clang/lib/linux/libclang_rt.fuzzer-x86_64.a
./test/Driver/Inputs/fake-resource-dir/lib/swift/clang/lib/linux/libclang_rt.ubsan-x86_64.a
./test/Driver/Inputs/fake-resource-dir/lib/swift/clang/lib/linux/libclang_rt.scudo-x86_64.a
./test/Driver/Inputs/fake-resource-dir/lib/swift/clang/lib/linux/libclang_rt.tsan-x86_64.a
./test/Driver/Inputs/fake-resource-dir/lib/swift/clang/lib/linux/libclang_rt.asan-x86_64.a
./test/Driver/Inputs/fake-resource-dir/lib/swift/clang/lib/darwin
./test/Driver/Inputs/fake-resource-dir/lib/swift/clang/lib/darwin/libclang_rt.ubsan_tvos_dynamic.dylib
./test/Driver/Inputs/fake-resource-dir/lib/swift/clang/lib/darwin/libclang_rt.ubsan_watchossim.a
./test/Driver/Inputs/fake-resource-dir/lib/swift/clang/lib/darwin/libclang_rt.ubsan_osx.a
./test/Driver/Inputs/fake-resource-dir/lib/swift/clang/lib/darwin/libclang_rt.ubsan_ios_dynamic.dylib
./test/Driver/Inputs/fake-resource-dir/lib/swift/clang/lib/darwin/libclang_rt.asan_watchos_dynamic.dylib
./test/Driver/Inputs/fake-resource-dir/lib/swift/clang/lib/darwin/libclang_rt.ubsan_osx_dynamic.dylib
./test/Driver/Inputs/fake-resource-dir/lib/swift/clang/lib/darwin/libclang_rt.ubsan_tvossim_dynamic.dylib
./test/Driver/Inputs/fake-resource-dir/lib/swift/clang/lib/darwin/libclang_rt.asan_iossim_dynamic.dylib
./test/Driver/Inputs/fake-resource-dir/lib/swift/clang/lib/darwin/libclang_rt.ubsan_watchos.a
./test/Driver/Inputs/fake-resource-dir/lib/swift/clang/lib/darwin/libclang_rt.asan_tvos_dynamic.dylib
./test/Driver/Inputs/fake-resource-dir/lib/swift/clang/lib/darwin/libclang_rt.asan_osx_dynamic.dylib
./test/Driver/Inputs/fake-resource-dir/lib/swift/clang/lib/darwin/libclang_rt.profile_tvossim.a
./test/Driver/Inputs/fake-resource-dir/lib/swift/clang/lib/darwin/libclang_rt.ubsan_tvos.a
./test/Driver/Inputs/fake-resource-dir/lib/swift/clang/lib/darwin/libclang_rt.ubsan_iossim_dynamic.dylib
./test/Driver/Inputs/fake-resource-dir/lib/swift/clang/lib/darwin/libclang_rt.asan_ios_dynamic.dylib
./test/Driver/Inputs/fake-resource-dir/lib/swift/clang/lib/darwin/libclang_rt.ubsan_iossim.a
./test/Driver/Inputs/fake-resource-dir/lib/swift/clang/lib/darwin/libclang_rt.ubsan_tvossim.a
./test/Driver/Inputs/fake-resource-dir/lib/swift/clang/lib/darwin/libclang_rt.ubsan_watchos_dynamic.dylib
./test/Driver/Inputs/fake-resource-dir/lib/swift/clang/lib/darwin/libclang_rt.ubsan_watchossim_dynamic.dylib
./test/Driver/Inputs/fake-resource-dir/lib/swift/clang/lib/darwin/libclang_rt.profile_watchossim.a
./test/Driver/Inputs/fake-resource-dir/lib/swift/clang/lib/darwin/libclang_rt.asan_watchossim_dynamic.dylib
./test/Driver/Inputs/fake-resource-dir/lib/swift/clang/lib/darwin/libclang_rt.fuzzer_osx.a
./test/Driver/Inputs/fake-resource-dir/lib/swift/clang/lib/darwin/libclang_rt.asan_tvossim_dynamic.dylib
./test/Driver/Inputs/fake-resource-dir/lib/swift/clang/lib/darwin/libclang_rt.tsan_osx_dynamic.dylib
./test/Driver/Inputs/fake-resource-dir/lib/swift/clang/lib/darwin/libclang_rt.ubsan_ios.a
./test/Driver/Inputs/fake-resource-dir/lib/swift/clang/lib/darwin/libclang_rt.profile_iossim.a
./test/Driver/Inputs/fake-resource-dir/lib/swift/clang/lib/windows
./test/Driver/Inputs/fake-resource-dir/lib/swift/clang/lib/windows/clang_rt.asan-x86_64.lib
./test/Driver/Inputs/fake-resource-dir/lib/swift/clang/lib/windows/clang_rt.ubsan-x86_64.lib
./test/Driver/Inputs/error.swift
./test/Driver/Inputs/MacOSX10.15.4.versioned.sdk
./test/Driver/Inputs/MacOSX10.15.4.versioned.sdk/SDKSettings.json
./test/Driver/Inputs/xcrun-return-self.sh
./test/Driver/Inputs/unicode.txt
./test/Driver/Inputs/MacOSX10.15.versioned.sdk
./test/Driver/Inputs/MacOSX10.15.versioned.sdk/SDKSettings.json
./test/Driver/Inputs/xcrun.sh
./test/Driver/Inputs/fail.py
./test/Driver/Inputs/filelists
./test/Driver/Inputs/filelists/fake-ld.py
./test/Driver/Inputs/filelists/output.json
./test/Driver/Inputs/filelists/check-filelist-abc.py
./test/Driver/Inputs/unicode-filenames.rsp
./test/Driver/Inputs/empty-ofm.json
./test/Driver/Inputs/print-var.sh
./test/Driver/Inputs/imported_modules
./test/Driver/Inputs/imported_modules/imported_modules_bridging_header.importedmodules
./test/Driver/Inputs/imported_modules/imported_modules_underlying
./test/Driver/Inputs/imported_modules/imported_modules_underlying/module.modulemap
./test/Driver/Inputs/imported_modules/imported_modules_underlying/outer.h
./test/Driver/Inputs/imported_modules/imported_modules_underlying/inner.h
./test/Driver/Inputs/imported_modules/imported_modules2.swift
./test/Driver/Inputs/imported_modules/imported_modules.importedmodules
./test/Driver/Inputs/imported_modules/InvalidOverlay.swiftmodule
./test/Driver/Inputs/imported_modules/bridging_header.h
./test/Driver/Inputs/imported_modules/imported_modules_underlying.importedmodules
./test/Driver/Inputs/imported_modules/InvalidOverlay
./test/Driver/Inputs/imported_modules/InvalidOverlay/module.modulemap
./test/Driver/Inputs/imported_modules/HasSubmodule
./test/Driver/Inputs/imported_modules/HasSubmodule/module.modulemap
./test/Driver/Inputs/IllformedModule.swiftmodule
./test/Driver/Inputs/crash-after-generating-pch.py
./test/Driver/Inputs/libEmpty.so
./test/Driver/Inputs/android.sdk
./test/Driver/Inputs/android.sdk/usr
./test/Driver/Inputs/android.sdk/usr/lib
./test/Driver/Inputs/android.sdk/usr/lib/swift
./test/Driver/Inputs/android.sdk/usr/lib/swift/android
./test/Driver/Inputs/android.sdk/usr/lib/swift/android/x86_64
./test/Driver/Inputs/android.sdk/usr/lib/swift/android/x86_64/Swift.swiftinterface
./test/Driver/Inputs/fake-toolchain
./test/Driver/Inputs/fake-toolchain/clang
./test/Driver/Inputs/fake-toolchain/ld
./test/Driver/Inputs/loaded_module_trace_empty.swift
./test/Driver/Inputs/loaded_module_trace_header.h
./test/Driver/Inputs/abcd_filemap.yaml
./test/Driver/Inputs/main.swift
./test/Driver/Inputs/invalid-module-name.swift
./test/Driver/Inputs/bridging-header.h
./test/Driver/Inputs/empty.sil
./test/Driver/Inputs/xcrun-empty.sh
./test/Driver/Inputs/你好.swift
./test/Driver/static-stdlib-linux.swift
./test/Driver/windows-libc-options.swift
./test/Driver/batch_mode_with_WMO_or_index.swift
./test/Driver/lock_interface.swift
./test/Driver/response-files-with-spaces-in-filenames.swift
./test/Driver/windows-link-job.swift
./test/Driver/sanitizers.swift
./test/Driver/driver-use-frontend.swift
./test/Driver/continue-building-after-errors.swift
./test/ImportResolution
./test/ImportResolution/import-resolution.swift
./test/ImportResolution/import-resolution-3.swift
./test/ImportResolution/testable-vs-indirect-import.swift
./test/ImportResolution/import-multiple-command-line.swift
./test/ImportResolution/import-resolution-2.swift
./test/ImportResolution/import-implementation-only.swift
./test/ImportResolution/scoped_imports.swift
./test/ImportResolution/import-command-line.swift
./test/ImportResolution/import-specific-decl.swift
./test/ImportResolution/import-resolution-overload_swift5.swift
./test/ImportResolution/import-resolution-overload.swift
./test/ImportResolution/import-specific-fixits.swift
./test/ImportResolution/Inputs
./test/ImportResolution/Inputs/ambiguous_left.swift
./test/ImportResolution/Inputs/DeclsUsedWrongly.swift
./test/ImportResolution/Inputs/letters.swift
./test/ImportResolution/Inputs/ambiguous.swift
./test/ImportResolution/Inputs/overload_boolFunctions.swift
./test/ImportResolution/Inputs/asdf.swift
./test/ImportResolution/Inputs/abcde.swift
./test/ImportResolution/Inputs/TestableVersusIndirect2.swift
./test/ImportResolution/Inputs/ambiguous_right.swift
./test/ImportResolution/Inputs/TestableVersusIndirectImporter.swift
./test/ImportResolution/Inputs/overlay.swift
./test/ImportResolution/Inputs/overload_intFunctions.swift
./test/ImportResolution/Inputs/TestableVersusIndirect1.swift
./test/ImportResolution/Inputs/sdf.swift
./test/ImportResolution/Inputs/ClangModuleWithOverlay
./test/ImportResolution/Inputs/ClangModuleWithOverlay/ClangModuleWithOverlay.h
./test/ImportResolution/Inputs/ClangModuleWithOverlay/module.modulemap
./test/ImportResolution/Inputs/aeiou.swift
./test/ImportResolution/Inputs/overload_vars.swift
./test/ImportResolution/import-resolution-overload_swift4.swift
./test/api-digester
./test/api-digester/compare-dump-parsable-interface.swift
./test/api-digester/compare-dump.swift
./test/api-digester/compare-clang-dump.swift
./test/api-digester/stability-stdlib-abi-with-asserts.swift
./test/api-digester/deserialize-diff-items.swift
./test/api-digester/compare-dump-binary-vs-interface.swift
./test/api-digester/apinotes-migrator-gen.swift
./test/api-digester/internal-extension.swift
./test/api-digester/diagnostics.json
./test/api-digester/dump-empty-baseline.swift
./test/api-digester/apinotes-diags.swift
./test/api-digester/macro-gen-json.swift
./test/api-digester/stability-stdlib-source.swift
./test/api-digester/stability-stdlib-abi-without-asserts.swift
./test/api-digester/dump-module.swift
./test/api-digester/macro-gen.swift
./test/api-digester/compare-dump-abi-parsable-interface.swift
./test/api-digester/clang-module-dump.swift
./test/api-digester/diagnostics.swift
./test/api-digester/Outputs
./test/api-digester/Outputs/apinotes-migrator-gen.json
./test/api-digester/Outputs/Cake-abi.txt
./test/api-digester/Outputs/Cake-binary-vs-interface.txt
./test/api-digester/Outputs/apinotes-diags-3-4.txt
./test/api-digester/Outputs/color_vs_empty.txt
./test/api-digester/Outputs/stability-stdlib-abi.asserts.additional.swift.expected
./test/api-digester/Outputs/empty-baseline.json
./test/api-digester/Outputs/clang-module-dump.txt
./test/api-digester/Outputs/macro-gen.json
./test/api-digester/Outputs/Cake.txt
./test/api-digester/Outputs/cake-abi.json
./test/api-digester/Outputs/apinotes-diags.txt
./test/api-digester/Outputs/mock-sdk-api.txt
./test/api-digester/Outputs/stability-stdlib-source.swift.expected
./test/api-digester/Outputs/cake.json
./test/api-digester/Outputs/apinotes-migrator-gen-revert.json
./test/api-digester/Outputs/macro-gen.def
./test/api-digester/Outputs/Foo-diff.txt
./test/api-digester/Outputs/stability-stdlib-abi.without.asserts.swift.expected
./test/api-digester/Outputs/color.txt
./test/api-digester/compare-two-sdks.swift
./test/api-digester/compare-dump-abi.swift
./test/api-digester/Inputs
./test/api-digester/Inputs/macro-gen-left.swift
./test/api-digester/Inputs/cake_current
./test/api-digester/Inputs/cake_current/cake.swift
./test/api-digester/Inputs/cake_current/color.swift
./test/api-digester/Inputs/APINotesRight
./test/api-digester/Inputs/APINotesRight/APINotesTest.h
./test/api-digester/Inputs/APINotesRight/APINotesTest.apinotes
./test/api-digester/Inputs/APINotesRight/module.modulemap
./test/api-digester/Inputs/ClangCake
./test/api-digester/Inputs/ClangCake/Cake.h
./test/api-digester/Inputs/ClangCake/module.modulemap
./test/api-digester/Inputs/ClangCake/Cake.apinotes
./test/api-digester/Inputs/cake_baseline
./test/api-digester/Inputs/cake_baseline/cake.swift
./test/api-digester/Inputs/cake_baseline/color.swift
./test/api-digester/Inputs/mock-sdk.sdk
./test/api-digester/Inputs/mock-sdk.sdk/System
./test/api-digester/Inputs/mock-sdk.sdk/System/Library
./test/api-digester/Inputs/mock-sdk.sdk/System/Library/Frameworks
./test/api-digester/Inputs/mock-sdk.sdk/System/Library/Frameworks/SwiftFoo.framework
./test/api-digester/Inputs/mock-sdk.sdk/System/Library/Frameworks/SwiftFoo.framework/Modules
./test/api-digester/Inputs/mock-sdk.sdk/System/Library/Frameworks/SwiftFoo.framework/Modules/SwiftFoo.swiftmodule
./test/api-digester/Inputs/mock-sdk.sdk/System/Library/Frameworks/SwiftFoo.framework/Modules/SwiftFoo.swiftmodule/x86_64-apple-macos.swiftinterface
./test/api-digester/Inputs/mock-sdk.sdk/System/Library/Frameworks/Foo.framework
./test/api-digester/Inputs/mock-sdk.sdk/System/Library/Frameworks/Foo.framework/module.map
./test/api-digester/Inputs/mock-sdk.sdk/System/Library/Frameworks/Foo.framework/Headers
./test/api-digester/Inputs/mock-sdk.sdk/System/Library/Frameworks/Foo.framework/Headers/Foo.h
./test/api-digester/Inputs/mock-sdk.sdk/System/Library/Frameworks/Foo.framework/Frameworks
./test/api-digester/Inputs/mock-sdk.sdk/System/Library/Frameworks/Foo.framework/Frameworks/FooSub.framework
./test/api-digester/Inputs/mock-sdk.sdk/System/Library/Frameworks/Foo.framework/Frameworks/FooSub.framework/Headers
./test/api-digester/Inputs/mock-sdk.sdk/System/Library/Frameworks/Foo.framework/Frameworks/FooSub.framework/Headers/FooSub.h
./test/api-digester/Inputs/APINotesLeft
./test/api-digester/Inputs/APINotesLeft/APINotesTest.h
./test/api-digester/Inputs/APINotesLeft/APINotesTest.apinotes
./test/api-digester/Inputs/APINotesLeft/module.modulemap
./test/api-digester/Inputs/mock-sdk-modules.txt
./test/api-digester/Inputs/cake.swift
./test/api-digester/Inputs/Foo
./test/api-digester/Inputs/Foo/foo.h
./test/api-digester/Inputs/Foo/module.modulemap
./test/api-digester/Inputs/macro-gen-right.swift
./test/api-digester/Inputs/mock-sdk-baseline.sdk
./test/api-digester/Inputs/mock-sdk-baseline.sdk/System
./test/api-digester/Inputs/mock-sdk-baseline.sdk/System/Library
./test/api-digester/Inputs/mock-sdk-baseline.sdk/System/Library/Frameworks
./test/api-digester/Inputs/mock-sdk-baseline.sdk/System/Library/Frameworks/SwiftFoo.framework
./test/api-digester/Inputs/mock-sdk-baseline.sdk/System/Library/Frameworks/SwiftFoo.framework/Modules
./test/api-digester/Inputs/mock-sdk-baseline.sdk/System/Library/Frameworks/SwiftFoo.framework/Modules/SwiftFoo.swiftmodule
./test/api-digester/Inputs/mock-sdk-baseline.sdk/System/Library/Frameworks/SwiftFoo.framework/Modules/SwiftFoo.swiftmodule/x86_64-apple-macos.swiftinterface
./test/api-digester/Inputs/mock-sdk-baseline.sdk/System/Library/Frameworks/Foo.framework
./test/api-digester/Inputs/mock-sdk-baseline.sdk/System/Library/Frameworks/Foo.framework/module.map
./test/api-digester/Inputs/mock-sdk-baseline.sdk/System/Library/Frameworks/Foo.framework/Headers
./test/api-digester/Inputs/mock-sdk-baseline.sdk/System/Library/Frameworks/Foo.framework/Headers/Foo.h
./test/api-digester/Inputs/mock-sdk-baseline.sdk/System/Library/Frameworks/Foo.framework/Frameworks
./test/api-digester/Inputs/mock-sdk-baseline.sdk/System/Library/Frameworks/Foo.framework/Frameworks/FooSub.framework
./test/api-digester/Inputs/mock-sdk-baseline.sdk/System/Library/Frameworks/Foo.framework/Frameworks/FooSub.framework/Headers
./test/api-digester/Inputs/mock-sdk-baseline.sdk/System/Library/Frameworks/Foo.framework/Frameworks/FooSub.framework/Headers/FooSub.h
./test/api-digester/Inputs/Foo-prot-whitelist.txt
./test/api-digester/Inputs/Foo-new-version
./test/api-digester/Inputs/Foo-new-version/foo.h
./test/api-digester/Inputs/Foo-new-version/module.modulemap
./test/sil-passpipeline-dump
./test/sil-passpipeline-dump/basic.test-sh
./test/Serialization
./test/Serialization/xref-private-type.swift
./test/Serialization/recursive_protocol_merge.swift
./test/Serialization/function_builders.swift
./test/Serialization/write-to-locked-dir.swift
./test/Serialization/default-witness-table-deserialization.swift
./test/Serialization/load-missing-dependency.swift
./test/Serialization/multi-file-nested-type-extension.swift
./test/Serialization/cross_module_optional_protocol_reqt.swift
./test/Serialization/extension_generation_number_1.swift
./test/Serialization/runtime-import-from-sdk.swift
./test/Serialization/comments-hidden.swift
./test/Serialization/early-serialization.swift
./test/Serialization/objc_xref.swift
./test/Serialization/basic_sil.swift
./test/Serialization/comments-params.swift
./test/Serialization/load-file-permissions.swift
./test/Serialization/opaque_types_inlineable.swift
./test/Serialization/xref-nested-clang-type.swift
./test/Serialization/array.swift
./test/Serialization/transparent.swift
./test/Serialization/apple-default-search-paths.swift
./test/Serialization/private_import.swift
./test/Serialization/vtable-lookup.swift
./test/Serialization/import-multi-file.swift
./test/Serialization/transparent-std.swift
./test/Serialization/multi-file-subclass-generic-instantiation.swift
./test/Serialization/inherited-conformance.swift
./test/Serialization/default_silfunction_deserializationfrom_stdlib.swift
./test/Serialization/load-wrong-name-doc.swift
./test/Serialization/circular-import.swift
./test/Serialization/objc.swift
./test/Serialization/generic_extension.swift
./test/Serialization/load-invalid-doc.swift
./test/Serialization/load-missing-dependencies.swift
./test/Serialization/operator.swift
./test/Serialization/sil-serialize-all-with-cross-module-conformance.swift
./test/Serialization/load-arch-fallback-framework.swift
./test/Serialization/generic_witness.swift
./test/Serialization/empty.swift
./test/Serialization/Recovery
./test/Serialization/Recovery/types-4-to-5.swift
./test/Serialization/Recovery/crash-recovery.swift
./test/Serialization/Recovery/protocol-inheritance.swift
./test/Serialization/Recovery/private-conformances.swift
./test/Serialization/Recovery/implementation-only-override.swift
./test/Serialization/Recovery/indirect-import-removal.swift
./test/Serialization/Recovery/typedefs.swift
./test/Serialization/Recovery/superclass.swift
./test/Serialization/Recovery/missing-clang-module-conformance.swift
./test/Serialization/Recovery/missing-clang-module.swift
./test/Serialization/Recovery/implementation-only-missing.swift
./test/Serialization/Recovery/type-removal-objc.swift
./test/Serialization/Recovery/overrides.swift
./test/Serialization/Recovery/typedefs-in-enums.swift
./test/Serialization/Recovery/rename-across-versions.swift
./test/Serialization/Recovery/typedefs-in-protocols.swift
./test/Serialization/Recovery/types-5-to-4.swift
./test/Serialization/Recovery/Inputs
./test/Serialization/Recovery/Inputs/implementation-only-override
./test/Serialization/Recovery/Inputs/implementation-only-override/FooKit_SECRET.h
./test/Serialization/Recovery/Inputs/implementation-only-override/module.modulemap
./test/Serialization/Recovery/Inputs/implementation-only-override/FooKit.h
./test/Serialization/Recovery/Inputs/implementation-only-missing
./test/Serialization/Recovery/Inputs/implementation-only-missing/module.modulemap
./test/Serialization/Recovery/Inputs/custom-modules
./test/Serialization/Recovery/Inputs/custom-modules/RenameAcrossVersions.h
./test/Serialization/Recovery/Inputs/custom-modules/Typedefs.h
./test/Serialization/Recovery/Inputs/custom-modules/Types.h
./test/Serialization/Recovery/Inputs/custom-modules/IndirectImport.h
./test/Serialization/Recovery/Inputs/custom-modules/ProtocolInheritance.h
./test/Serialization/Recovery/Inputs/custom-modules/Types.apinotes
./test/Serialization/Recovery/Inputs/custom-modules/IndirectlyImported.h
./test/Serialization/Recovery/Inputs/custom-modules/SuperclassObjC.h
./test/Serialization/Recovery/Inputs/custom-modules/Overrides.h
./test/Serialization/Recovery/Inputs/custom-modules/Conformance.h
./test/Serialization/Recovery/Inputs/custom-modules/TypeRemovalObjC.h
./test/Serialization/Recovery/Inputs/custom-modules/module.modulemap
./test/Serialization/Recovery/Inputs/typedefs-helper.swift
./test/Serialization/target-incompatible.swift
./test/Serialization/comments-framework.swift
./test/Serialization/load-invalid-arch.swift
./test/Serialization/load-target-fallback.swift
./test/Serialization/multi-file-nested-type-simple.swift
./test/Serialization/alignment.swift
./test/Serialization/xref-generic-params.swift
./test/Serialization/override.swift
./test/Serialization/objc_method_table.swift
./test/Serialization/always_inline.swift
./test/Serialization/extension_generation_number_2.swift
./test/Serialization/load-wrong-name.swift
./test/Serialization/noinline.swift
./test/Serialization/multi-file-type-eraser.swift
./test/Serialization/vtable-function-deserialization.swift
./test/Serialization/xref-generic-opaque-type.swift
./test/Serialization/multi-module-nested-type-extension.swift
./test/Serialization/comments-batch-mode.swift
./test/Serialization/search-paths-relative.swift
./test/Serialization/load-target-normalization.swift
./test/Serialization/conformance-multi-file.swift
./test/Serialization/sil_partial_apply_ownership.sil
./test/Serialization/class-determinism.swift
./test/Serialization/imported_enum_merge.swift
./test/Serialization/witnesstable-function-deserialization.swift
./test/Serialization/version-mismatches.swift
./test/Serialization/clang-function-types.swift
./test/Serialization/enum-mutual-circularity.swift
./test/Serialization/sil-imported-enums.swift
./test/Serialization/search-paths.swift
./test/Serialization/typealias.swift
./test/Serialization/nested-type-with-overlay.swift
./test/Serialization/load-arch-fallback.swift
./test/Serialization/interface-module-nested-types.swift
./test/Serialization/inherited-initializer.swift
./test/Serialization/target-too-new.swift
./test/Serialization/multi-file-protocol-circularity.swift
./test/Serialization/autolinking.swift
./test/Serialization/xref.swift
./test/Serialization/top-level-code.swift
./test/Serialization/sil_box_types.sil
./test/Serialization/android-modules.swift
./test/Serialization/property_wrappers.swift
./test/Serialization/function-default-args.swift
./test/Serialization/extension-of-typealias.swift
./test/Serialization/basic_sil_objc.swift
./test/Serialization/class.swift
./test/Serialization/opaque_circularity.swift
./test/Serialization/global_init.swift
./test/Serialization/target-too-new-ios.swift
./test/Serialization/serialize_attr.swift
./test/Serialization/xref-multi-file.swift
./test/Serialization/swiftdoc-versions.swift
./test/Serialization/stored_property_default_arg.swift
./test/Serialization/multi-file.swift
./test/Serialization/use-class-bound-protocol.swift
./test/Serialization/module-merging-implementation-only.swift
./test/Serialization/class-roundtrip-module.swift
./test/Serialization/objc_optional_reqs.swift
./test/Serialization/import.swift
./test/Serialization/comments.swift
./test/Serialization/testability.swift
./test/Serialization/generic_subscript.swift
./test/Serialization/nested_generic_extension.swift
./test/Serialization/optimized.swift
./test/Serialization/duplicate_normalprotocolconformance.swift
./test/Serialization/import_source.swift
./test/Serialization/load-invalid.swift
./test/Serialization/failed-partial-module.swift
./test/Serialization/function.swift
./test/Serialization/load.swift
./test/Serialization/builtin.swift
./test/Serialization/ownership.swift
./test/Serialization/group_info_diags.swift
./test/Serialization/opaque_cross_file.swift
./test/Serialization/enum.swift
./test/Serialization/xref-extensions-counters.swift
./test/Serialization/multi-file-nested-type-circularity.swift
./test/Serialization/resilience.swift
./test/Serialization/Inputs
./test/Serialization/Inputs/multi-file-nested-types-extensions.swift
./test/Serialization/Inputs/xref-nested-clang-type
./test/Serialization/Inputs/xref-nested-clang-type/NestedClangTypes.h
./test/Serialization/Inputs/xref-nested-clang-type/NestedClangTypesHelper.h
./test/Serialization/Inputs/xref-nested-clang-type/module.modulemap
./test/Serialization/Inputs/conformance-multi-file-other.swift
./test/Serialization/Inputs/private_import_other.swift
./test/Serialization/Inputs/def_xref_extensions_distraction.swift
./test/Serialization/Inputs/inherited-conformance-base.swift
./test/Serialization/Inputs/autolinking_module_inferred.swift
./test/Serialization/Inputs/autolinking_implementation_only.swift
./test/Serialization/Inputs/has_array.swift
./test/Serialization/Inputs/depends_on_new_module.swift
./test/Serialization/Inputs/xref-multi-file-other.swift
./test/Serialization/Inputs/SwiftModB.swift
./test/Serialization/Inputs/def_property_wrappers.swift
./test/Serialization/Inputs/comments-batch
./test/Serialization/Inputs/comments-batch/File2.swift
./test/Serialization/Inputs/comments-batch/File4.swift
./test/Serialization/Inputs/comments-batch/File1.swift
./test/Serialization/Inputs/comments-batch/File3.swift
./test/Serialization/Inputs/comments-batch/File5.swift
./test/Serialization/Inputs/swiftdoc-versions
./test/Serialization/Inputs/swiftdoc-versions/empty-1.1.swiftdoc
./test/Serialization/Inputs/swiftdoc-versions/empty-1.0.swiftdoc
./test/Serialization/Inputs/swiftdoc-versions/empty-257.1.swiftdoc
./test/Serialization/Inputs/swiftdoc-versions/empty-1.257.swiftdoc
./test/Serialization/Inputs/swiftdoc-versions/empty-0.7.swiftdoc
./test/Serialization/Inputs/use_imported_enums.swift
./test/Serialization/Inputs/objcfail
./test/Serialization/Inputs/objcfail/objcfail.h
./test/Serialization/Inputs/objcfail/module.modulemap
./test/Serialization/Inputs/def_basic_objc.sil
./test/Serialization/Inputs/generic_extension_1.swift
./test/Serialization/Inputs/cross_module_optional_protocol_reqt_2.swift
./test/Serialization/Inputs/def_struct.swift
./test/Serialization/Inputs/has_nested_generic_extension.swift
./test/Serialization/Inputs/def_enum.swift
./test/Serialization/Inputs/autolinking_indirect.swift
./test/Serialization/Inputs/comments-params.json
./test/Serialization/Inputs/top-level-code-other.swift
./test/Serialization/Inputs/def_func.swift
./test/Serialization/Inputs/has_generic_subscript_proto.swift
./test/Serialization/Inputs/def_enum_derived.swift
./test/Serialization/Inputs/xref-generic-params-other-extensions-mixed.swift
./test/Serialization/Inputs/alias.swift
./test/Serialization/Inputs/struct_with_operators.swift
./test/Serialization/Inputs/xref-generic-params-other-extensions.swift
./test/Serialization/Inputs/autolinking_other.swift
./test/Serialization/Inputs/duplicate_normalprotocolconformance_input.swift
./test/Serialization/Inputs/private_import_other_2.swift
./test/Serialization/Inputs/has_xref.swift
./test/Serialization/Inputs/autolinking_other2.swift
./test/Serialization/Inputs/transparent_invalid.swift
./test/Serialization/Inputs/xref-generic-params-other.swift
./test/Serialization/Inputs/classes.swift
./test/Serialization/Inputs/multi-file-type-eraser.swift
./test/Serialization/Inputs/xref-private-type
./test/Serialization/Inputs/xref-private-type/Lib.swift
./test/Serialization/Inputs/xref-private-type/LibCore.swift
./test/Serialization/Inputs/def_operator.swift
./test/Serialization/Inputs/SwiftModA.swift
./test/Serialization/Inputs/vtable-function-deserialization-input.swift
./test/Serialization/Inputs/cross_module_optional_protocol_reqt.h
./test/Serialization/Inputs/too-new
./test/Serialization/Inputs/too-new/Library.swiftmodule
./test/Serialization/Inputs/binary_sub.py
./test/Serialization/Inputs/alias_builtin.swift
./test/Serialization/Inputs/def_override.swift
./test/Serialization/Inputs/def_noinline.swift
./test/Serialization/Inputs/import-multi-file-other.swift
./test/Serialization/Inputs/xref-generic-params-other-extensions-constrained.swift
./test/Serialization/Inputs/too-new-language
./test/Serialization/Inputs/too-new-language/Library.swiftmodule
./test/Serialization/Inputs/def_class.swift
./test/Serialization/Inputs/def_clang_function_types.swift
./test/Serialization/Inputs/inherited-initializer-base.swift
./test/Serialization/Inputs/multi-module-nested-type-1.swift
./test/Serialization/Inputs/enum-mutual-circularity-client.swift
./test/Serialization/Inputs/def_objc_conforming.swift
./test/Serialization/Inputs/recursive_protocol_merge_a.swift
./test/Serialization/Inputs/inherited-conformance-lib.swift
./test/Serialization/Inputs/too-old
./test/Serialization/Inputs/too-old/Library.swiftmodule
./test/Serialization/Inputs/group_info.json
./test/Serialization/Inputs/def_xref_extensions.swift
./test/Serialization/Inputs/def_transparent.swift
./test/Serialization/Inputs/nested-type-with-overlay
./test/Serialization/Inputs/nested-type-with-overlay/verify.swift
./test/Serialization/Inputs/nested-type-with-overlay/HasOverlay.h
./test/Serialization/Inputs/nested-type-with-overlay/overlay.swift
./test/Serialization/Inputs/nested-type-with-overlay/module.modulemap
./test/Serialization/Inputs/def_always_inline.swift
./test/Serialization/Inputs/def_basic.sil
./test/Serialization/Inputs/has_generic_witness.swift
./test/Serialization/Inputs/xref-opaque-generic-type
./test/Serialization/Inputs/xref-opaque-generic-type/best-protocol.swift
./test/Serialization/Inputs/xref-opaque-generic-type/output.json
./test/Serialization/Inputs/circular-protocols
./test/Serialization/Inputs/circular-protocols/b.swift
./test/Serialization/Inputs/circular-protocols/c.swift
./test/Serialization/Inputs/circular-protocols/a.swift
./test/Serialization/Inputs/xref_distraction.swift
./test/Serialization/Inputs/inherited-conformance-user.swift
./test/Serialization/Inputs/corrupted_group_info.json
./test/Serialization/Inputs/too-old-language
./test/Serialization/Inputs/too-old-language/Library.swiftmodule
./test/Serialization/Inputs/multi-file-subclass-generic-instantiation-extension.swift
./test/Serialization/Inputs/OpaqueCrossFileB.swift
./test/Serialization/Inputs/multi-file-nested-types.swift
./test/Serialization/Inputs/multi-file-2.swift
./test/Serialization/Inputs/witnesstable-function-deserialization-input.swift
./test/Serialization/Inputs/multi-module-nested-type-2.swift
./test/Serialization/Inputs/opaque_types_inlineable_2.swift
./test/Serialization/Inputs/has_generic_subscript.swift
./test/Serialization/Inputs/class-bound-protocol.swift
./test/Serialization/Inputs/recursive_protocol_merge_b.swift
./test/Serialization/Inputs/def_objc.swift
./test/Serialization/Inputs/def_comments.swift
./test/Serialization/Inputs/extension_generation_number.swift
./test/Serialization/Inputs/MixModA.modulemap
./test/Serialization/Inputs/stored_property_default_arg_testable.swift
./test/Serialization/Inputs/enum-mutual-circularity-2.swift
./test/Serialization/Inputs/def_objc_xref.swift
./test/Serialization/Inputs/autolinking_private.swift
./test/Serialization/Inputs/def_transparent_std.swift
./test/Serialization/Inputs/objc_method_decls.swift
./test/Serialization/Inputs/autolinking_public.swift
./test/Serialization/struct.swift
./test/Serialization/failed-clang-module.swift
./test/Serialization/autolinking-inlinable-inferred.swift
./test/Serialization/attr-invalid.swift
./test/sil-opt
./test/sil-opt/emit-sib.swift
./test/sil-opt/sil-opt.swift
./test/sil-opt/Inputs
./test/sil-opt/Inputs/guaranteed-normal-args.swift
./test/Interop
./test/Interop/Cxx
./test/Interop/Cxx/operators
./test/Interop/Cxx/operators/non-member-inline-typechecker.swift
./test/Interop/Cxx/operators/non-member-out-of-line-silgen.swift
./test/Interop/Cxx/operators/non-member-inline.swift
./test/Interop/Cxx/operators/non-member-out-of-line-irgen.swift
./test/Interop/Cxx/operators/non-member-out-of-line.swift
./test/Interop/Cxx/operators/Inputs
./test/Interop/Cxx/operators/Inputs/non-member-out-of-line.cpp
./test/Interop/Cxx/operators/Inputs/non-member-out-of-line.h
./test/Interop/Cxx/operators/Inputs/non-member-inline.h
./test/Interop/Cxx/operators/Inputs/module.modulemap
./test/Interop/Cxx/operators/non-member-inline-module-interface.swift
./test/Interop/Cxx/static
./test/Interop/Cxx/static/static-var-irgen.swift
./test/Interop/Cxx/static/inline-static-member-var-irgen.swift
./test/Interop/Cxx/static/static-member-func.swift
./test/Interop/Cxx/static/constexpr-static-member-var.swift
./test/Interop/Cxx/static/static-member-var-irgen.swift
./test/Interop/Cxx/static/static-member-var-silgen.swift
./test/Interop/Cxx/static/static-local-var.swift
./test/Interop/Cxx/static/inline-static-member-var-silgen.swift
./test/Interop/Cxx/static/static-member-var.swift
./test/Interop/Cxx/static/static-var.swift
./test/Interop/Cxx/static/static-member-func-silgen.swift
./test/Interop/Cxx/static/static-var-silgen.swift
./test/Interop/Cxx/static/static-member-func-irgen.swift
./test/Interop/Cxx/static/Inputs
./test/Interop/Cxx/static/Inputs/inline-static-member-var.cpp
./test/Interop/Cxx/static/Inputs/static-var.h
./test/Interop/Cxx/static/Inputs/static-member-var.h
./test/Interop/Cxx/static/Inputs/static-member-var.cpp
./test/Interop/Cxx/static/Inputs/static-var.cpp
./test/Interop/Cxx/static/Inputs/static-local-var.h
./test/Interop/Cxx/static/Inputs/static-member-func.h
./test/Interop/Cxx/static/Inputs/static-local-var.cpp
./test/Interop/Cxx/static/Inputs/module.modulemap
./test/Interop/Cxx/static/Inputs/inline-static-member-var.h
./test/Interop/Cxx/static/Inputs/static-member-func.cpp
./test/Interop/Cxx/static/inline-static-member-var.swift
./test/Interop/Cxx/class
./test/Interop/Cxx/class/access-specifiers-typechecker.swift
./test/Interop/Cxx/class/memory-layout-silgen.swift
./test/Interop/Cxx/class/member-variables-module-interface.swift
./test/Interop/Cxx/class/memberwise-initializer-module-interface.swift
./test/Interop/Cxx/class/protocol-conformance-silgen.swift
./test/Interop/Cxx/class/access-specifiers-module-interface.swift
./test/Interop/Cxx/class/member-variables-typechecker.swift
./test/Interop/Cxx/class/memory-layout-execution.swift
./test/Interop/Cxx/class/memberwise-initializer-typechecker.swift
./test/Interop/Cxx/class/protocol-conformance-typechecker.swift
./test/Interop/Cxx/class/loadable-types-silgen.swift
./test/Interop/Cxx/class/Inputs
./test/Interop/Cxx/class/Inputs/protocol-conformance.h
./test/Interop/Cxx/class/Inputs/memory-layout.h
./test/Interop/Cxx/class/Inputs/loadable-types.h
./test/Interop/Cxx/class/Inputs/module.modulemap
./test/Interop/Cxx/class/Inputs/memberwise-initializer.h
./test/Interop/Cxx/class/Inputs/member-variables.h
./test/Interop/Cxx/class/Inputs/access-specifiers.h
./test/Interop/Cxx/extern-var
./test/Interop/Cxx/extern-var/extern-var.swift
./test/Interop/Cxx/extern-var/extern-var-silgen.swift
./test/Interop/Cxx/extern-var/extern-var-irgen.swift
./test/Interop/Cxx/extern-var/Inputs
./test/Interop/Cxx/extern-var/Inputs/extern-var.cpp
./test/Interop/Cxx/extern-var/Inputs/extern-var.h
./test/Interop/Cxx/extern-var/Inputs/module.modulemap
./test/Interop/Cxx/reference
./test/Interop/Cxx/reference/reference-module-interface.swift
./test/Interop/Cxx/reference/reference.swift
./test/Interop/Cxx/reference/reference-silgen.swift
./test/Interop/Cxx/reference/reference-irgen.swift
./test/Interop/Cxx/reference/Inputs
./test/Interop/Cxx/reference/Inputs/reference.cpp
./test/Interop/Cxx/reference/Inputs/reference.h
./test/Interop/Cxx/reference/Inputs/module.modulemap
./test/Interop/C
./test/Interop/C/function
./test/Interop/C/function/emit-called-inline-function-irgen.swift
./test/Interop/C/function/Inputs
./test/Interop/C/function/Inputs/emit-called-inline-function.h
./test/Interop/C/function/Inputs/module.modulemap
./test/Interop/C/struct
./test/Interop/C/struct/struct-decl-context-module-interface.swift
./test/Interop/C/struct/struct-decl-context-irgen.swift
./test/Interop/C/struct/Inputs
./test/Interop/C/struct/Inputs/struct-decl-context.h
./test/Interop/C/struct/Inputs/module.modulemap
./test/DWARFImporter
./test/DWARFImporter/basic.swift
./test/DWARFImporter/Inputs
./test/DWARFImporter/Inputs/objc-header.h
./test/DWARFImporter/Inputs/module.modulemap
./test/multifile
./test/multifile/protocol-conformance-objc.swift
./test/multifile/requirement-signature.swift
./test/multifile/error-type
./test/multifile/error-type/one-module
./test/multifile/error-type/one-module/main.swift
./test/multifile/error-type/one-module/Inputs
./test/multifile/error-type/one-module/Inputs/library.swift
./test/multifile/error-type/imported
./test/multifile/error-type/imported/main.swift
./test/multifile/error-type/imported/Inputs
./test/multifile/error-type/imported/Inputs/objc_enum_errortype.h
./test/multifile/error-type/imported/Inputs/library.swift
./test/multifile/error-type/two-modules
./test/multifile/error-type/two-modules/main.swift
./test/multifile/error-type/two-modules/Inputs
./test/multifile/error-type/two-modules/Inputs/library.swift
./test/multifile/imported-conformance
./test/multifile/imported-conformance/option-set
./test/multifile/imported-conformance/option-set/main.swift
./test/multifile/imported-conformance/option-set/Inputs
./test/multifile/imported-conformance/option-set/Inputs/library.swift
./test/multifile/default-witness.swift
./test/multifile/protocol-extension-init.swift
./test/multifile/property-wrappers-rdar51725203.swift
./test/multifile/require-layout-generic-arg.swift
./test/multifile/protocol-conformance.swift
./test/multifile/synthesized-accessors
./test/multifile/synthesized-accessors/one-module-public
./test/multifile/synthesized-accessors/one-module-public/main.swift
./test/multifile/synthesized-accessors/one-module-public/Inputs
./test/multifile/synthesized-accessors/one-module-public/Inputs/library.swift
./test/multifile/synthesized-accessors/materialize-for-set-2
./test/multifile/synthesized-accessors/materialize-for-set-2/main.swift
./test/multifile/synthesized-accessors/materialize-for-set-2/Inputs
./test/multifile/synthesized-accessors/materialize-for-set-2/Inputs/library2.swift
./test/multifile/synthesized-accessors/materialize-for-set-2/Inputs/counter.h
./test/multifile/synthesized-accessors/materialize-for-set-2/Inputs/library1.swift
./test/multifile/synthesized-accessors/materialize-for-set-2/Inputs/module.map
./test/multifile/synthesized-accessors/invalid
./test/multifile/synthesized-accessors/invalid/main.swift
./test/multifile/synthesized-accessors/invalid/Inputs
./test/multifile/synthesized-accessors/invalid/Inputs/library.swift
./test/multifile/synthesized-accessors/one-module-imported
./test/multifile/synthesized-accessors/one-module-imported/main.swift
./test/multifile/synthesized-accessors/one-module-imported/Inputs
./test/multifile/synthesized-accessors/one-module-imported/Inputs/library.swift
./test/multifile/synthesized-accessors/one-module-internal
./test/multifile/synthesized-accessors/one-module-internal/main.swift
./test/multifile/synthesized-accessors/one-module-internal/Inputs
./test/multifile/synthesized-accessors/one-module-internal/Inputs/library.swift
./test/multifile/synthesized-accessors/two-modules
./test/multifile/synthesized-accessors/two-modules/main.swift
./test/multifile/synthesized-accessors/two-modules/Inputs
./test/multifile/synthesized-accessors/two-modules/Inputs/library.swift
./test/multifile/synthesized-accessors/two-modules-imported
./test/multifile/synthesized-accessors/two-modules-imported/main.swift
./test/multifile/synthesized-accessors/two-modules-imported/Inputs
./test/multifile/synthesized-accessors/two-modules-imported/Inputs/library.swift
./test/multifile/synthesized-accessors/materialize-for-set-1
./test/multifile/synthesized-accessors/materialize-for-set-1/main.swift
./test/multifile/synthesized-accessors/materialize-for-set-1/Inputs
./test/multifile/synthesized-accessors/materialize-for-set-1/Inputs/library.swift
./test/multifile/synthesized-accessors/materialize-for-set-1/Inputs/counter.h
./test/multifile/synthesized-accessors/materialize-for-set-1/Inputs/module.map
./test/multifile/objc-protocol.swift
./test/multifile/finalize-nested-types.swift
./test/multifile/protocol-conformance-rdar31302713.swift
./test/multifile/typealias
./test/multifile/typealias/one-module
./test/multifile/typealias/one-module/main.swift
./test/multifile/typealias/one-module/Inputs
./test/multifile/typealias/one-module/Inputs/library.swift
./test/multifile/typealias/two-modules
./test/multifile/typealias/two-modules/main.swift
./test/multifile/typealias/two-modules/Inputs
./test/multifile/typealias/two-modules/Inputs/library.swift
./test/multifile/resilient-module.swift
./test/multifile/require-layout-enum.swift
./test/multifile/function_builder_multifile.swift
./test/multifile/batch_mode_external_definitions.swift
./test/multifile/external-protocol-conformance.swift
./test/multifile/nested_types.swift
./test/multifile/default-arguments
./test/multifile/default-arguments/one-module
./test/multifile/default-arguments/one-module/invalid-magic-literals.swift
./test/multifile/default-arguments/one-module/mismatched-magic-literals.swift
./test/multifile/default-arguments/one-module/main.swift
./test/multifile/default-arguments/one-module/Inputs
./test/multifile/default-arguments/one-module/Inputs/mismatched-magic-literals-other.swift
./test/multifile/default-arguments/one-module/Inputs/library.swift
./test/multifile/default-arguments/one-module/Inputs/invalid-magic-literals-other.swift
./test/multifile/default-arguments/two-modules
./test/multifile/default-arguments/two-modules/main.swift
./test/multifile/default-arguments/two-modules/Inputs
./test/multifile/default-arguments/two-modules/Inputs/library2.swift
./test/multifile/default-arguments/two-modules/Inputs/library1.swift
./test/multifile/require-layout-error.swift
./test/multifile/override.swift
./test/multifile/constant-tuple-with-padding
./test/multifile/constant-tuple-with-padding/main.swift
./test/multifile/constant-tuple-with-padding/Inputs
./test/multifile/constant-tuple-with-padding/Inputs/other.swift
./test/multifile/require-finalize-witness.swift
./test/multifile/protocol-conformance-sr6839.swift
./test/multifile/multiconformanceimpls
./test/multifile/multiconformanceimpls/main.swift
./test/multifile/multiconformanceimpls/Inputs
./test/multifile/multiconformanceimpls/Inputs/B.swift
./test/multifile/multiconformanceimpls/Inputs/C.swift
./test/multifile/multiconformanceimpls/Inputs/A.swift
./test/multifile/nested_types
./test/multifile/nested_types/main.swift
./test/multifile/extensions
./test/multifile/extensions/one-module
./test/multifile/extensions/one-module/main.swift
./test/multifile/extensions/one-module/Inputs
./test/multifile/extensions/one-module/Inputs/library.swift
./test/multifile/extensions/two-modules
./test/multifile/extensions/two-modules/main.swift
./test/multifile/extensions/two-modules/Inputs
./test/multifile/extensions/two-modules/Inputs/library.swift
./test/multifile/protocol-override.swift
./test/multifile/require-member-layout-dynamic.swift
./test/multifile/property-wrappers-sr10933.swift
./test/multifile/class-layout
./test/multifile/class-layout/final-stored-property
./test/multifile/class-layout/final-stored-property/main.swift
./test/multifile/class-layout/final-stored-property/Inputs
./test/multifile/class-layout/final-stored-property/Inputs/library.swift
./test/multifile/property-wrappers-sr11458.swift
./test/multifile/resilient-witness.swift
./test/multifile/for_each_conformance_crash.swift
./test/multifile/protocol-conformance-member.swift
./test/multifile/require-layout-generic-arg-closure.swift
./test/multifile/protocol-conformance-rdar39805133.swift
./test/multifile/protocol-conformance-broken.swift
./test/multifile/require-layout
./test/multifile/require-layout/main.swift
./test/multifile/protocol-conformance-sr11018.swift
./test/multifile/require-layout-generic-arg-subscript.swift
./test/multifile/constant-struct-with-padding
./test/multifile/constant-struct-with-padding/main.swift
./test/multifile/constant-struct-with-padding/Inputs
./test/multifile/constant-struct-with-padding/Inputs/other.swift
./test/multifile/protocol-conformance-rdar-34584596.swift
./test/multifile/property-wrappers-sr12429.swift
./test/multifile/protocol-conformance-let.swift
./test/multifile/inlinable.swift
./test/multifile/inherited-inits.swift
./test/multifile/require-layout-call-result.swift
./test/multifile/require-layout3
./test/multifile/require-layout3/main.swift
./test/multifile/property-wrappers-rdar61229365.swift
./test/multifile/batch-mode-llvmIRHash-consistency.swift
./test/multifile/lazy.swift
./test/multifile/outlined-thunks.swift
./test/multifile/require-layout2
./test/multifile/require-layout2/main.swift
./test/multifile/objc_closure_escape
./test/multifile/objc_closure_escape/main.swift
./test/multifile/Inputs
./test/multifile/Inputs/rdar61229365.swift
./test/multifile/Inputs/objc-escape
./test/multifile/Inputs/objc-escape/Escaper.m
./test/multifile/Inputs/objc-escape/DangerousEscaper.swift
./test/multifile/Inputs/objc-escape/Escaper.h
./test/multifile/Inputs/requirement-signature.swift
./test/multifile/Inputs/overrideB.swift
./test/multifile/Inputs/function_builder_definition.swift
./test/multifile/Inputs/sr12429.swift
./test/multifile/Inputs/default-witness.swift
./test/multifile/Inputs/outlined-thunks-other.swift
./test/multifile/Inputs/protocol-override-other.swift
./test/multifile/Inputs/require-layout-generic-class.swift
./test/multifile/Inputs/inlinable-other.swift
./test/multifile/Inputs/objc-protocol-other.swift
./test/multifile/Inputs/external-protocol-conformance
./test/multifile/Inputs/external-protocol-conformance/A.swift
./test/multifile/Inputs/batch_mode_external_uses_1.swift
./test/multifile/Inputs/require-layout-enum-other.swift
./test/multifile/Inputs/nested_types_defs.swift
./test/multifile/Inputs/protocol-conformance-let-other.swift
./test/multifile/Inputs/resilient-witness-2.swift
./test/multifile/Inputs/sr11458.swift
./test/multifile/Inputs/batch_mode_external_definitions.h
./test/multifile/Inputs/require-finalize-witness-other.swift
./test/multifile/Inputs/protocol-conformance-member-helper.swift
./test/multifile/Inputs/overrideC.swift
./test/multifile/Inputs/external_lazy_property.swift
./test/multifile/Inputs/finalize-nested-types-other.swift
./test/multifile/Inputs/batch_mode_external_uses_2.swift
./test/multifile/Inputs/protocol-extension-init-helper.swift
./test/multifile/Inputs/require-member-layout-dynamic-other.swift
./test/multifile/Inputs/require-layout-error-other.swift
./test/multifile/Inputs/rdar-34584596-A.swift
./test/multifile/Inputs/objc-protocol-bridging.h
./test/multifile/Inputs/rdar-34584596-C.swift
./test/multifile/Inputs/protocol-conformance
./test/multifile/Inputs/protocol-conformance/broken.swift
./test/multifile/Inputs/protocol-conformance/A.swift
./test/multifile/Inputs/protocol-conformance/rdar31302713.swift
./test/multifile/Inputs/protocol-conformance-rdar39805133-other.swift
./test/multifile/Inputs/sr10933b.swift
./test/multifile/Inputs/rdar51725203.swift
./test/multifile/Inputs/protocol-conformance-sr11018-other.swift
./test/multifile/Inputs/inherited-inits-other.swift
./test/multifile/Inputs/require-layout-call-result-primary.swift
./test/multifile/Inputs/sr-285-other.swift
./test/multifile/Inputs/for_each_conformance_crashB.swift
./test/multifile/Inputs/protocol-conformance-sr6839-other.swift
./test/multifile/Inputs/rdar-34584596-B.swift
./test/multifile/Inputs/protocol-conformance-objc-other.swift
./test/multifile/Inputs/sr10933a.swift
./test/multifile/Inputs/resilient-module-2.swift
./test/multifile/Inputs/require-member-layout-dynamic-bridging.h
./test/multifile/protocol-conformance-sr-285.swift
./test/Parse
./test/Parse/pointer_conversion_objc.swift.gyb
./test/Parse/utf8_bom.swift
./test/Parse/try_swift5.swift
./test/Parse/invalid.swift
./test/Parse/dollar_identifier.swift
./test/Parse/form_feed_char.swift
./test/Parse/multiline_normalize_newline.swift
./test/Parse/hashbang_main.swift
./test/Parse/conflict_markers.swift
./test/Parse/source_locs.swift
./test/Parse/metatype_object_conversion.swift
./test/Parse/structure_overflow.swift
./test/Parse/toplevel_library_invalid.swift
./test/Parse/structure_no_overflow.swift
./test/Parse/number_identifier_errors.swift
./test/Parse/invalid_string_interpolation_protocol.swift
./test/Parse/diagnose_availability.swift
./test/Parse/operator_decl_designated_types.swift
./test/Parse/deprecated_where.swift
./test/Parse/raw_string_errors.swift
./test/Parse/generic_disambiguation.swift
./test/Parse/delayed_extension.swift
./test/Parse/diagnostic_points_to_first_bad_token.swift
./test/Parse/consecutive_statements.swift
./test/Parse/implicit_uninhabited_conversion.swift
./test/Parse/operator_decl.swift
./test/Parse/guard-top-level.swift
./test/Parse/pointer_conversion.swift.gyb
./test/Parse/invalid-utf8.swift
./test/Parse/enum_element_pattern_swift4.swift
./test/Parse/brace_recovery_eof.swift
./test/Parse/switch_incomplete.swift
./test/Parse/pattern_without_variables_script.swift
./test/Parse/raw_string.swift
./test/Parse/omit_return_objc.swift
./test/Parse/invalid_if_expr.swift
./test/Parse/objc_enum.swift
./test/Parse/original_defined_in_attr.swift
./test/Parse/swift3_warnings_swift4_errors_version_4.swift
./test/Parse/omit_return.swift
./test/Parse/utf16_bom.swift
./test/Parse/try.swift
./test/Parse/diagnose_initializer_as_typed_pattern.swift
./test/Parse/string_literal_eof6.swift
./test/Parse/playground_lvalues.swift
./test/Parse/operators.swift
./test/Parse/typealias.swift
./test/Parse/multiline_pound_diagnostic_arg_rdar_41154797.swift
./test/Parse/omit_return_fail.swift
./test/Parse/fixed_infinite_loops.swift
./test/Parse/pattern_without_variables.swift
./test/Parse/line-directive.swift
./test/Parse/identifiers.swift
./test/Parse/structure_overflow_paren_exprs.swift
./test/Parse/subscripting.swift
./test/Parse/if_expr.swift
./test/Parse/strange_interpolation.swift
./test/Parse/switch.swift
./test/Parse/string_literal_eof4.swift
./test/Parse/matching_patterns.swift
./test/Parse/type_expr.swift
./test/Parse/pound_assert.swift
./test/Parse/optional_chain_lvalues.swift
./test/Parse/super.swift
./test/Parse/strange-characters.swift
./test/Parse/nonbreaking_space.swift
./test/Parse/trailing-semi.swift
./test/Parse/recovery_library.swift
./test/Parse/diagnostic_missing_func_keyword.swift
./test/Parse/string_literal_eof2.swift
./test/Parse/multiline_errors.swift
./test/Parse/init_deinit.swift
./test/Parse/semicolon.swift
./test/Parse/multiline_string.swift
./test/Parse/diagnose_dynamicReplacement.swift
./test/Parse/string_literal_eof5.swift
./test/Parse/escaped_identifiers.swift
./test/Parse/errors.swift
./test/Parse/builtin_word.swift
./test/Parse/availability_query.swift
./test/Parse/recovery.swift
./test/Parse/hashbang_library.swift
./test/Parse/multiple_trailing_closures.swift
./test/Parse/toplevel_library.swift
./test/Parse/string_literal_eof7.swift
./test/Parse/weakLinked.swift
./test/Parse/ConditionalCompilation
./test/Parse/ConditionalCompilation/armAndroidTarget.swift
./test/Parse/ConditionalCompilation/switch_case_executable.swift
./test/Parse/ConditionalCompilation/decl_in_true_inactive.swift
./test/Parse/ConditionalCompilation/pound-if-inside-function-3.swift
./test/Parse/ConditionalCompilation/language_version_explicit.swift
./test/Parse/ConditionalCompilation/armWatchOSTarget.swift
./test/Parse/ConditionalCompilation/i386WatchOSTarget.swift
./test/Parse/ConditionalCompilation/basicDeclarations.swift
./test/Parse/ConditionalCompilation/i386AppleTVOSTarget.swift
./test/Parse/ConditionalCompilation/x64CygwinTarget.swift
./test/Parse/ConditionalCompilation/can_import_idempotent.swift
./test/Parse/ConditionalCompilation/canimport_in_inactive.swift
./test/Parse/ConditionalCompilation/topLevelDeclarations.swift
./test/Parse/ConditionalCompilation/pound-if-inside-function-2.swift
./test/Parse/ConditionalCompilation/decl_parse_errors.swift
./test/Parse/ConditionalCompilation/switch_case.swift
./test/Parse/ConditionalCompilation/pound-if-inside-function.swift
./test/Parse/ConditionalCompilation/x64IOSTarget.swift
./test/Parse/ConditionalCompilation/arm64IOSTarget.swift
./test/Parse/ConditionalCompilation/sequence.swift
./test/Parse/ConditionalCompilation/x64AppleTVOSTarget.swift
./test/Parse/ConditionalCompilation/aarch64AndroidTarget.swift
./test/Parse/ConditionalCompilation/module_top_level.swift
./test/Parse/ConditionalCompilation/invalid-runtime-name.swift
./test/Parse/ConditionalCompilation/can_import_sdk.swift
./test/Parse/ConditionalCompilation/sequence_version.swift
./test/Parse/ConditionalCompilation/pound-if-inside-function-4.swift
./test/Parse/ConditionalCompilation/pound-if-inside-statement-2.swift
./test/Parse/ConditionalCompilation/x64OSXTarget.swift
./test/Parse/ConditionalCompilation/arm64AppleTVOSTarget.swift
./test/Parse/ConditionalCompilation/x86_64PS4Target.swift
./test/Parse/ConditionalCompilation/identifierName.swift
./test/Parse/ConditionalCompilation/can_import.swift
./test/Parse/ConditionalCompilation/x64WindowsTarget.swift
./test/Parse/ConditionalCompilation/pound-if-top-level-4.swift
./test/Parse/ConditionalCompilation/compiler.swift
./test/Parse/ConditionalCompilation/pound-if-top-level-nested.swift
./test/Parse/ConditionalCompilation/powerpc64leLinuxTarget.swift
./test/Parse/ConditionalCompilation/rdar19548610.swift
./test/Parse/ConditionalCompilation/trailingClosureOnTargetConfig.swift
./test/Parse/ConditionalCompilation/stmt_in_type.swift
./test/Parse/ConditionalCompilation/x64FreeBSDTarget.swift
./test/Parse/ConditionalCompilation/simulatorTargetEnv.swift
./test/Parse/ConditionalCompilation/pound-if-top-level.swift
./test/Parse/ConditionalCompilation/pound-if-top-level-2.swift
./test/Parse/ConditionalCompilation/endif-on-end-of-file.swift
./test/Parse/ConditionalCompilation/no_configuration_error1.swift
./test/Parse/ConditionalCompilation/compoundName_swift4.swift
./test/Parse/ConditionalCompilation/pound-if-inside-statement.swift
./test/Parse/ConditionalCompilation/decl_parse_errors-2.swift
./test/Parse/ConditionalCompilation/s390xLinuxTarget.swift
./test/Parse/ConditionalCompilation/toplevel_parseaslibrary.swift
./test/Parse/ConditionalCompilation/armIOSTarget.swift
./test/Parse/ConditionalCompilation/powerpc64LinuxTarget.swift
./test/Parse/ConditionalCompilation/basicParseErrors.swift
./test/Parse/ConditionalCompilation/basicIdentity.swift
./test/Parse/ConditionalCompilation/pound-if-top-level-clean.swift
./test/Parse/ConditionalCompilation/macabiTargetEnv.swift
./test/Parse/ConditionalCompilation/pound-if-top-level-3.swift
./test/Parse/ConditionalCompilation/i386IOSTarget.swift
./test/Parse/ConditionalCompilation/language_version.swift
./test/Parse/ConditionalCompilation/compiler_version.swift
./test/Parse/ConditionalCompilation/no_configuration_error2.swift
./test/Parse/ConditionalCompilation/Inputs
./test/Parse/ConditionalCompilation/Inputs/rdar19548610a.swift
./test/Parse/ConditionalCompilation/Inputs/rdar19548610b.swift
./test/Parse/ConditionalCompilation/Inputs/can_import_nonprimary_file.swift
./test/Parse/ConditionalCompilation/wasm32Target.swift
./test/Parse/ConditionalCompilation/x64LinuxTarget.swift
./test/Parse/confusables.swift
./test/Parse/builtin_bridge_object.swift
./test/Parse/object_literals.swift
./test/Parse/line-directive-executable.swift
./test/Parse/self_rebinding.swift
./test/Parse/optional.swift
./test/Parse/EOF
./test/Parse/EOF/unterminated-string-literal-missing-newline.swift
./test/Parse/EOF/block-comment-nested.swift
./test/Parse/EOF/interpolated-string-literal.swift
./test/Parse/EOF/block-comment.swift
./test/Parse/EOF/block-comment-missing-newline.swift
./test/Parse/EOF/unfinished-for-at-eof.swift
./test/Parse/string_literal_eof3.swift
./test/Parse/enum.swift
./test/Parse/c_function_pointers.swift
./test/Parse/optional_lvalues.swift
./test/Parse/string_literal_eof1.swift
./test/Parse/debugger.swift
./test/Parse/closure-debugger.swift
./test/Parse/implicit_getter_incomplete.swift
./test/Parse/warning_primary_file.swift
./test/Parse/foreach.swift
./test/Parse/comment_operator.swift
./test/Parse/Inputs
./test/Parse/Inputs/imported_enums.swift
./test/Parse/Inputs/warning_nonprimary_file.swift
./test/ModuleInterface
./test/ModuleInterface/function_builders.swift
./test/ModuleInterface/static-initialize-objc-metadata-attr.swift
./test/ModuleInterface/lazy-vars.swift
./test/ModuleInterface/skip-redundant-conformances.swift
./test/ModuleInterface/force-load-autolink.swift
./test/ModuleInterface/enums-layout.swift
./test/ModuleInterface/inherits-superclass-initializers-client.swift
./test/ModuleInterface/private-stored-member-type-layout.swift
./test/ModuleInterface/Conformances.swiftinterface
./test/ModuleInterface/inlinable-function.swift
./test/ModuleInterface/multiple-targets-same-interface.swift
./test/ModuleInterface/swift_build_sdk_interfaces
./test/ModuleInterface/swift_build_sdk_interfaces/xfails.test-sh
./test/ModuleInterface/swift_build_sdk_interfaces/compiler-crash-windows.test-sh
./test/ModuleInterface/swift_build_sdk_interfaces/compiler-crash.test-sh
./test/ModuleInterface/swift_build_sdk_interfaces/find-modules.test-sh
./test/ModuleInterface/swift_build_sdk_interfaces/check-only-mode.swift
./test/ModuleInterface/swift_build_sdk_interfaces/track-system-dependencies.swift
./test/ModuleInterface/swift_build_sdk_interfaces/lit.local.cfg
./test/ModuleInterface/swift_build_sdk_interfaces/compiler-uses-prebuilt.swift
./test/ModuleInterface/swift_build_sdk_interfaces/early-exits.test-sh
./test/ModuleInterface/swift_build_sdk_interfaces/xfail-logs.test-sh
./test/ModuleInterface/swift_build_sdk_interfaces/machine-parseable-monotonic-version.py
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/xfail-logs-framework
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/xfail-logs-framework/BadFMWK.framework
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/xfail-logs-framework/BadFMWK.framework/Modules
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/xfail-logs-framework/BadFMWK.framework/Modules/BadFMWK.swiftmodule
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/xfail-logs-framework/BadFMWK.framework/Modules/BadFMWK.swiftmodule/x86_64-apple-macos.swiftinterface
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/xfails-sdk
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/xfails-sdk/usr
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/xfails-sdk/usr/lib
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/xfails-sdk/usr/lib/swift
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/xfails-sdk/usr/lib/swift/Good.swiftinterface
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/xfails-sdk/usr/lib/swift/Bad.swiftinterface
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/xfails-sdk/usr/lib/swift/Swift.swiftinterface
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/system-dependencies-sdk
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/system-dependencies-sdk/usr
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/system-dependencies-sdk/usr/include
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/system-dependencies-sdk/usr/include/module.modulemap
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/system-dependencies-sdk/usr/include/Platform.h
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/system-dependencies-sdk/usr/lib
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/system-dependencies-sdk/usr/lib/swift
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/system-dependencies-sdk/usr/lib/swift/Swifty.swiftmodule
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/system-dependencies-sdk/usr/lib/swift/Swifty.swiftmodule/dummy-file-so-git-includes-this-otherwise-empty-directory
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/mock-sdk
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/mock-sdk/usr
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/mock-sdk/usr/lib
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/mock-sdk/usr/lib/swift
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/mock-sdk/usr/lib/swift/Flat.swiftinterface
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/mock-sdk/usr/lib/swift/Normal.swiftmodule
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/mock-sdk/usr/lib/swift/Normal.swiftmodule/xyz.swiftinterface
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/mock-sdk/System
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/mock-sdk/System/iOSSupport
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/mock-sdk/System/iOSSupport/usr
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/mock-sdk/System/iOSSupport/usr/lib
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/mock-sdk/System/iOSSupport/usr/lib/swift
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/mock-sdk/System/iOSSupport/usr/lib/swift/Caramel.swiftmodule
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/mock-sdk/System/iOSSupport/usr/lib/swift/Caramel.swiftmodule/xyz.swiftinterface
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/mock-sdk/System/iOSSupport/System
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/mock-sdk/System/iOSSupport/System/Library
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/mock-sdk/System/iOSSupport/System/Library/Frameworks
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/mock-sdk/System/iOSSupport/System/Library/Frameworks/Simple.framework
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/mock-sdk/System/iOSSupport/System/Library/Frameworks/Simple.framework/Modules
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/mock-sdk/System/iOSSupport/System/Library/Frameworks/Simple.framework/Modules/Simple.swiftmodule
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/mock-sdk/System/iOSSupport/System/Library/Frameworks/Simple.framework/Modules/Simple.swiftmodule/xyzzy.swiftinterface
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/mock-sdk/System/Library
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/mock-sdk/System/Library/PrivateFrameworks
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/mock-sdk/System/Library/PrivateFrameworks/PrivateSimple.framework
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/mock-sdk/System/Library/PrivateFrameworks/PrivateSimple.framework/Modules
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/mock-sdk/System/Library/PrivateFrameworks/PrivateSimple.framework/Modules/PrivateSimple.swiftmodule
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/mock-sdk/System/Library/PrivateFrameworks/PrivateSimple.framework/Modules/PrivateSimple.swiftmodule/xyz.swiftinterface
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/mock-sdk/System/Library/Frameworks
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/mock-sdk/System/Library/Frameworks/Simple.framework
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/mock-sdk/System/Library/Frameworks/Simple.framework/Modules
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/mock-sdk/System/Library/Frameworks/Simple.framework/Modules/Simple.swiftmodule
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/mock-sdk/System/Library/Frameworks/Simple.framework/Modules/Simple.swiftmodule/xyz.swiftinterface
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/mock-sdk/System/Library/Frameworks/BinaryOnly_BAD.framework
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/mock-sdk/System/Library/Frameworks/BinaryOnly_BAD.framework/Modules
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/mock-sdk/System/Library/Frameworks/BinaryOnly_BAD.framework/Modules/BinaryOnly_BAD.swiftmodule
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/mock-sdk/System/Library/Frameworks/BinaryOnly_BAD.framework/Modules/BinaryOnly_BAD.swiftmodule/xyz.swiftmodule
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/mock-sdk/System/Library/Frameworks/FlatInterface_BAD.framework
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/mock-sdk/System/Library/Frameworks/FlatInterface_BAD.framework/Modules
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/mock-sdk/System/Library/Frameworks/FlatInterface_BAD.framework/Modules/FlatInterface_BAD.swiftinterface
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/mock-sdk/System/Library/Frameworks/HasNested_BAD.framework
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/mock-sdk/System/Library/Frameworks/HasNested_BAD.framework/Frameworks
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/mock-sdk/System/Library/Frameworks/HasNested_BAD.framework/Frameworks/Nested.framework
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/mock-sdk/System/Library/Frameworks/HasNested_BAD.framework/Frameworks/Nested.framework/Modules
./test/ModuleInterface/swift_build_sdk_interfaces/Inputs/mock-sdk/System/Library/Frameworks/HasNested_BAD.framework/Frameworks/Ne
Sign up for free to join this conversation on GitHub. Already have an account? Sign in to comment