David Pattinson davipatti
davipatti
/ sonos-sleep.py
Created
November 11, 2020 04:34
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| #!/usr/bin/env python3 | |
| """ | |
| Set a sleep timer on a Sonos speaker. | |
| Example: | |
| $ python sonos-sleep.py --name Bathroom --minutes 20 | |
| """ | |
| import argparse |
This file has been truncated, but you can view the full file.
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| ATOM 1 MN1 GLN A 44 43.240 91.770 46.070 1.00 0.00 | |
| ATOM 2 MN2 GLN A 44 43.780 92.310 45.780 1.00 0.00 | |
| ATOM 3 N GLN A 44 43.490 92.030 45.870 1.00 0.00 N | |
| ATOM 4 H1 GLN A 44 42.960 91.470 46.520 1.00 0.00 H | |
| ATOM 5 H2 GLN A 44 44.480 91.830 45.970 1.00 0.00 H | |
| ATOM 6 H3 GLN A 44 43.340 93.010 46.060 1.00 0.00 H | |
| ATOM 7 CA GLN A 44 43.070 91.710 44.490 1.00 0.00 C | |
| ATOM 8 HA GLN A 44 41.970 91.720 44.520 1.00 0.00 H | |
| ATOM 9 CB GLN A 44 43.480 92.850 43.500 1.00 0.00 C | |
| ATOM 10 HB1 GLN A 44 42.840 93.720 43.700 1.00 0.00 H |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| #!/usr/bin/env python | |
| # Extracting xy coordinates from an svg path using svgpathtools | |
| # https://github.com/mathandy/svgpathtools | |
| # pip install svgpathtools | |
| from svgpathtools import parse_path | |
| import numpy as np | |
| path = "M 125.09006,141.18848 C 110.99811,164.35846 111.22868,108.07854 83.831725,113.54159 56.434773,119.00464 91.156393,169.4818 61.713214,168.35114 32.270035,167.22048 81.822001,142.5491 60.875654,122.49307 39.929306,102.43705 13.745665,149.24722 6.4082722,121.25037 -0.92912038,93.253532 42.338807,123.59851 43.351984,95.418206 44.365161,67.2379 -6.2345334,65.117335 11.759409,43.777931 29.753351,22.438526 42.683955,75.303807 69.420586,63.044694 96.157218,50.78558 64.480031,7.6180619 90.699813,14.891972 c 26.219787,7.27391 -22.120071,45.96694 0.83756,61.421875 22.957637,15.454936 45.837447,-38.115775 52.856287,-9.974186 7.01884,28.141589 -35.94694,7.378485 -41.50034,35.827669 -5.553398,28.44918 36.28869,15.85118 22.19674,39.02115 z" |
davipatti
/ jupyter-nb-pelican-fields.txt
Created
July 13, 2020 16:08
Jupyter notebook pelican fields
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| - title: | |
| - date: | |
| - summary: | |
| - author: | |
| - category: |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| RAxML-NG v. 0.9.0git released on 26.11.2019 by The Exelixis Lab. | |
| Developed by: Alexey M. Kozlov and Alexandros Stamatakis. | |
| Contributors: Diego Darriba, Tomas Flouri, Benoit Morel, Sarah Lutteropp, Ben Bettisworth. | |
| Latest version: https://github.com/amkozlov/raxml-ng | |
| Questions/problems/suggestions? Please visit: https://groups.google.com/forum/#!forum/raxml | |
| RAxML-NG was called at 02-Jun-2020 09:39:21 as follows: | |
| ./raxml-ng --tree pars{1} --msa b-nuc.translated.sort.hd1.curated.fasta --prefix FLU --model FLU+F+I --log VERBOSE --threads 8 |
This file has been truncated, but you can view the full file.
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| >B/PENNSYLVANIA/1/2007_h207B7D2B#2007-02-26# | |
| DRICTGITSSNSPHVVKTATQGEVNVTGVIPLTTTPTKSYFANLKGTRTRGKLCPDCLNCTDLDVALGRPMCVGTTPSAKASILHEVRPVTSGCFPIMHDRTKIRQLPNLLRGYENIRLSTQNVIDAEKAPGGPYRLGTSGSCPNATSKSGFFATMAWAVPK-DNNKNATNPQTVEVPYICTEGEDQITVWGFHSDNKIQMKNLYGDSNPQKFTSSANGVTTHYVSQIGGFPDQTEDGGLPQSGRIVVDYMMQKPGKTGTIVYQRGVLLPQKVWCASGRSKVIKGSLPLIGEADCLHEKYGGLNKSKPYYTGEHAKAIGNCPIWVKTPLKLANGTKYRPPAKLLKERGFFGAIAGFLEGGWEGMIAGWHGYTSHGAHGVAVAADLKSTQEAINKITKNLNSLSELEVKNLQRLSGAMDELHNEILELDEKVDDLRADTISSQIELAVLLSNEGIINSEDEHLLALERKLKKMLGPSAVDIGNGCFETKHKCNQTCLDRIAAGTFNAGEFSLPTFDSLNITAASLNDDGLDNHTILLYYSTAASSLAVTLMLAIFIVYMVSKDNVSCSICL | |
| >B/PENNSYLVANIA/1/2007_h095F9CB8#2007-02-26# | |
| DRICTGITSSNSPHVVKTATQGEVNVTGVIPLTTTPTKSYFANLKGTRTRGKLCPDCLNCTDLDVALGRPMCVGTTPSAKASILHEVRPVTSGCFPIMHDRTKIRQLPNLLRGYENIRLSTQNVIDAEKAPGGPYRLGTSGSCPNATSKSGFFATMAWAVPK-DNNKNATNPQTVEVPYICTEGEDQITVWGFHSDKKTQMKNLYGDSNPQKFTSSANGVTTHYVSQIGGFPDQTEDGGLPQSGRIVVDYMMQKPGKTGTIVYQRGVLLPQKVWCASGRSKVIKGSLPLIGEADCLHEKYGGLNKSKPYYTGEHAKAIGNCPIWVKTPLKLANGTKYRPPAKLLKERGFFGAIAGFLEGGWEG |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| david@puck~/D/lc0> ./build.sh | |
| ~/Downloads/lc0 ~/Downloads/lc0 | |
| [0/1] Regenerating build files. | |
| The Meson build system | |
| Version: 0.51.2 | |
| Source dir: /home/david/Downloads/lc0 | |
| Build dir: /home/david/Downloads/lc0/build/release | |
| Build type: native build | |
| Project name: lc0 | |
| Project version: undefined |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| david@puck~/D/lc0> ./build.sh | |
| ~/Downloads/lc0 ~/Downloads/lc0 | |
| [0/1] Regenerating build files. | |
| The Meson build system | |
| Version: 0.51.2 | |
| Source dir: /home/david/Downloads/lc0 | |
| Build dir: /home/david/Downloads/lc0/build/release | |
| Build type: native build | |
| Project name: lc0 | |
| Project version: undefined |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| david@puck~/D/lc0> ./build.sh | |
| ~/Downloads/lc0 ~/Downloads/lc0 | |
| [0/1] Regenerating build files. | |
| The Meson build system | |
| Version: 0.51.2 | |
| Source dir: /home/david/Downloads/lc0 | |
| Build dir: /home/david/Downloads/lc0/build/release | |
| Build type: native build | |
| Project name: lc0 | |
| Project version: undefined |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| david@puck~/D/lc0> ./build.sh | |
| ~/Downloads/lc0 ~/Downloads/lc0 | |
| The Meson build system | |
| Version: 0.51.2 | |
| Source dir: /home/david/Downloads/lc0 | |
| Build dir: /home/david/Downloads/lc0/build/release | |
| Build type: native build | |
| Project name: lc0 | |
| Project version: undefined | |
| C++ compiler for the host machine: ccache c++ (gcc 9.2.1 "c++ (Ubuntu 9.2.1-9ubuntu2) 9.2.1 20191008") |