Last active
August 30, 2019 12:05
-
-
Save jhcepas/868b1057d9c0b72a57b809a67ad6e4cc to your computer and use it in GitHub Desktop.
given a tree and its associated alignment, plot column changes for each internal branch
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
from collections import defaultdict | |
from ete3 import PhyloTree, TreeStyle, SeqMotifFace, TextFace, RectFace | |
alg = """ | |
>Dme_001 | |
MAEIPDETIQQFMALT---HNIAVQYLSEFGDLNEAL--YYASQTDDIKDRREEAH | |
>Dme_002 | |
MAEIPDATIQQFMALTNVSHNIAVQY--EFGDLNEALNSYYAYQTDDQKDRREEAH | |
>Cfa_001 | |
MAEIPDATIQ---ALTNVSHNIAVQYLSEFGDLNEALNSYYASQTDDQPDRREEAH | |
>Mms_001 | |
MAEAPDETIQQFMALTNVSHNIAVQYLSEFGDLNEAL--------------REEAH | |
>Hsa_001 | |
MAEIPDETIQQFMALT---HNIAVQYLSEFGDLNEALNSYYASQTDDIKDRREEAH | |
>Ptr_002 | |
MAEIPDATIQ-FMALTNVSHNIAVQY--EFGDLNEALNSY--YQTDDQKDRREEAH | |
>Mmu_002 | |
MAEIPDATIQ---ALTNVSHNIAVQYLSEFGDLNEALNSYYASQTDDQPDRREEAH | |
>Hsa_002 | |
MAEAPDETIQQFM-LTNVSHNIAVQYLSEFGDLNEAL--------------REEAH | |
>Ptr_001 | |
MAEIPDATIQ-FMALTNVSHNIAVQY--EFGDLNEALNSY--YQTDDQKDRREEAH | |
>Mmu_001 | |
MAEIPDTTIQ---ALTNVSHNIAVQYLSEFGDLNEALNSYYASQTDDQPDRREEAH | |
""" | |
def mutation_columns(sequences): | |
col2diffs = defaultdict(set) | |
alg_length = len(sequences[0]) | |
for col in xrange(alg_length): | |
for seq in sequences: | |
col2diffs[col].add(seq[col]) | |
col2diffs[col].discard('-') | |
subseqs = set() | |
relevant_columns = [] | |
for col in xrange(alg_length): | |
if len(col2diffs[col]) > 1: | |
relevant_columns.append(col) | |
for seq in sequences: | |
subseqs.add(''.join([seq[col] for col in relevant_columns])) | |
return subseqs, relevant_columns | |
def get_example_tree(): | |
# Performs a tree reconciliation analysis | |
gene_tree_nw = '((Dme_001,Dme_002),(((Cfa_001,Mms_001),((Hsa_001,Ptr_001),Mmu_001)),(Ptr_002,(Hsa_002,Mmu_002))));' | |
t = PhyloTree(gene_tree_nw) | |
ts = TreeStyle() | |
# disable default PhyloTree Layout | |
ts.layout_fn = lambda x: True | |
t.link_to_alignment(alg) | |
node2content = t.get_cached_content() | |
for node in t.traverse(): | |
node.img_style["size"] = 0 | |
if not node.is_leaf(): | |
leaves = node2content[node] | |
# get columns with different aa | |
subseqs, relevant_columns = mutation_columns([lf.sequence for lf in leaves]) | |
for seq in subseqs: | |
f = SeqMotifFace(seq, seq_format="seq", width=10, height=8) | |
f.margin_top = 2 | |
f.margin_right = 6 | |
node.add_face(f, column=0, position="branch-bottom") | |
for j, col in enumerate(relevant_columns): | |
col_f = RectFace(10, 10, fgcolor=None, bgcolor=None, | |
label={"text":str(col), "fonttype":"Courier", "color":"black", "fontsize":6}) | |
node.add_face(col_f, column=j, position="branch-top") | |
col_f.margin_bottom = 2 | |
else: | |
f = SeqMotifFace(node.sequence, seq_format="seq", width=6) | |
node.add_face(f, column=0, position="aligned") | |
alg_length = len(lf.sequence) | |
ts.draw_aligned_faces_as_table = False | |
for colnum in xrange(alg_length): | |
col_f = RectFace(10, 10, fgcolor=None, bgcolor=None, | |
label={"text":str(colnum), "fonttype":"Courier", "color":"black", "fontsize":6}) | |
ts.aligned_header.add_face(col_f, column=colnum) | |
return t, ts | |
if __name__ == "__main__": | |
t, ts = get_example_tree() | |
t.show(tree_style=ts) |
Sign up for free
to join this conversation on GitHub.
Already have an account?
Sign in to comment
Resulting image