Created
May 16, 2011 21:46
-
-
Save jtprince/975439 to your computer and use it in GitHub Desktop.
Digestor Specification
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| require 'spec/more' | |
| require 'digestor' | |
| describe "Digestor" do | |
| before do | |
| @seq = "MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN" | |
| end | |
| it 'digests a protein' do | |
| names = %w(Trypsin Trypsin/P Arg-C Asp-N Chymotrypsin CNBr+Trypsin) | |
| names.each do |name| | |
| digestor = Digestor.new(name) | |
| (0..9).each do |missed_cleavages| | |
| peptides = digestor.digest(@seq, :missed_cleavages => missed_cleavages) | |
| peptides.size.isnt 0 | |
| end | |
| end | |
| end | |
| end |
Sign up for free
to join this conversation on GitHub.
Already have an account?
Sign in to comment