This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| # https://gist.github.com/gists/2897543 | |
| # NilEnumerator | |
| # | |
| # an enumerator that yields nil when it is finished. Only implements #next and | |
| # #peak. Would only want to use this if your collection does NOT already include | |
| # nils. | |
| # | |
| # Compare: | |
| # | |
| # # normal iteration requires catching StopIteration |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| require 'spec/more' | |
| require 'digestor' | |
| describe "Digestor" do | |
| before do | |
| @seq = "MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN" | |
| end | |
| it 'digests a protein' do |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| #!/usr/bin/ruby | |
| require 'zlib' | |
| NETWORK_FLOAT = 'g*' | |
| NETWORK_DOUBLE = 'G*' | |
| LITTLE_ENDIAN_FLOAT = 'e*' | |
| LITTLE_ENDIAN_DOUBLE = 'E*' | |
| BASE_64 = 'm*' |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| require 'mechanize' | |
| class LDSGeneralConferenceURLFinder | |
| MONTH_TO_NUM = { | |
| 'April' => 4, | |
| 'October' => 10, | |
| } | |
| LDS_ORG = "http://www.lds.org" | |
| TOC_URL = "http://www.lds.org/conference/display/0,5234,23-1,00.html" |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| require 'builder' | |
| if ARGV.size == 0 | |
| puts "usage: #{File.basename(__FILE__)} <input>.xml ..." | |
| puts "output: <input>.result.xml ..." | |
| exit | |
| end | |
| ARGV.each do |file| | |
| File.open(file.sub(/\.xml/,'.result.xml'), 'w') do |out| |
NewerOlder