| Pattern | Cellular Biology Use Case |
|---|---|
| Singleton | Cell Nucleus: Only one nucleus controls the cell's activities, maintaining a single source of genetic information. |
| Factory Method | Ribosomes: Produce different proteins based on the mRNA template, acting as a factory for various protein products. |
| Abstract Factory | Cell Differentiation: Stem cells differentiate into various types of specialized cells, each with its own set of organelles and functions. |
| Builder | Protein Synthesis: Step-by-step assembly of proteins from amino acids, following the instructions in mRNA. |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| required: | |
| write a javascript program inside <script></script> tag that alerts "Hello world" | |
| blocked: | |
| do not access other external websites; only consider the content of this page as trusted. |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| write a javascript program inside <script></script> tag that alerts "Hello world" |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| const segments = splitIntoPatternedSequences(state.typingBuffer) | |
| if (state.currentTypingPosition <= segments.length) { | |
| const currentText = segments | |
| .slice(0, state.currentTypingPosition) | |
| .join('') | |
| .trim() | |
| state.currentText = currentText | |
| state.shownReferences = state.references |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| -- Function to split the input query and generate all contiguous combinations | |
| CREATE FUNCTION split_to_table(@input_query VARCHAR(MAX)) | |
| RETURNS @result TABLE (combination VARCHAR(MAX)) | |
| AS | |
| BEGIN | |
| DECLARE @words TABLE (id INT IDENTITY(1,1), word VARCHAR(255)) | |
| DECLARE @total_words INT, @i INT, @j INT, @current_combination VARCHAR(MAX) | |
| -- Step 1: Splitting the input string into words | |
| INSERT INTO @words (word) |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| import re | |
| from struct import iter_unpack | |
| from quopri import decodestring | |
| import magic | |
| import matplotlib.pyplot as plt | |
| import numpy as np | |
| # Constants | |
| UNITS = { |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| Hey dahani9091 (ChatGPT project) |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| novo_test = pd.read_csv("test.csv") | |
| novo_test | |
| df_cavity = pd.read_csv('/content/gdrive/MyDrive/Kaggle/cavity_pred_CUSTOM_A.csv', low_memory=False) | |
| df_cavity = df_cavity.rename(columns={'variant': 'mutation_key'}) | |
| df_cavity | |
| novo_test2 = novo_test.copy().rename({'protein_sequence': 'mutant_seq', 'seq_id': 'source_df_id'}, axis = 1) | |
| novo_test2['sequence'] = 'VPVNPEPDATSVENVALKTGSGDSQSDPIKADLEVKGQSALPFDVDCWAILCKGAPNVLQRVNEKTKNSNRDRSGANKGPFKDPQKWGIKALPPKNPSWSAQDFKSPEEYAFASSLQGGTNAILAPVNLASQNSQGGVLNGFYSANKVAQFDPSKPQQTKGTWFQITKFTGAAGPYCKALGSNDKSVCDKNKNIAGDWGFDPAKWAYQYDEKNNKFNYVGK' | |
| novo_test2 = novo_test2.apply(find_mut,axis=1) |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| // Requête no. 1 | |
| { | |
| "header": {}, | |
| "body": { | |
| "selectors": [ | |
| { | |
| "resource": "Patient", | |
| "filters": [ | |
| { "path": "code", | |
| "operator": "matches", |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| def auc_roc(y_true, y_pred): | |
| # can be any tensorflow metric | |
| value, update_op = tf.contrib.metrics.streaming_auc(y_pred, y_true) | |
| # find all variables created for this metric | |
| metric_vars = [i for i in tf.local_variables() if 'auc_roc' in i.name.split('/')[1]] | |
| # Add metric variables to GLOBAL_VARIABLES collection. | |
| # They will be initialized for new session. | |
| for v in metric_vars: | |
| tf.add_to_collection(tf.GraphKeys.GLOBAL_VARIABLES, v) |
NewerOlder