Skip to content

Instantly share code, notes, and snippets.

@olas
Created May 4, 2009 09:37
Show Gist options
  • Select an option

  • Save olas/106393 to your computer and use it in GitHub Desktop.

Select an option

Save olas/106393 to your computer and use it in GitHub Desktop.
Call hivpred with plugin installed
/*******************************************************************************
* Script to predict the susceptibility of an HIV protease sequence for seven
* drugs based on the proteochemometric model described in:
* Lapins M, Eklund M, Spjuth O, Prusis P, Wikberg JE.
* Proteochemometric modeling of HIV protease susceptibility,
* BMC Bioinformatics. 2008 Apr 10;9:181. .
*
* Script accepts a 99 aa sequence as input and delivers susceptbiliy values
* for the drugs Amprenavir, Atazanavir, Indinavir, Lopinavir, Nelfinavir,
* Ritonavir, and Saquinavir.
*
* Requires the feature 'se.uu.farmbio.hivpred_feature' to be installed
*
* Script author: Ola Spjuth <ola.spjuth@farmbio.uu.se>
*
******************************************************************************/
var seq="PQITLWQRPIVTIKIGGQLREALLDTGADNTVLEEMNLPGRWKPKMIVGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRDLLTQIGCTLNF";
hivpred.predict(seq)
Sign up for free to join this conversation on GitHub. Already have an account? Sign in to comment