Skip to content

Instantly share code, notes, and snippets.

@paralax
Last active August 29, 2015 14:16
Show Gist options
  • Save paralax/a8090309e06915d7f82b to your computer and use it in GitHub Desktop.
Save paralax/a8090309e06915d7f82b to your computer and use it in GitHub Desktop.
sequence alignment challenge

Title DNA and Protein Sequence Alignment

Difficulty Hard

Description

If you are studying a particular pair of genes or proteins, an important question is to what extent the two sequences are similar. To quantify similarity, it is necessary to align the two sequences, and then you can calculate a similarity score based on the alignment.

There are two types of alignment in general. A global alignment is an alignment of the full length of two sequences, for example, of two protein sequences or of two DNA sequences. A local alignment is an alignment of part of one sequence to part of another sequence.

Alignment treats the two inputs as a linear sequence to be lined up as much as possible, with optional gaps and conversions allowed. The goal is to minimize these differences.

The first step in computing a alignment (global or local) is to decide on a scoring system. For this exercise, we'll simplify this and give a score of +2 to a match and a penalty of -1 to a mismatch, and a penalty of -2 to a gap.

(In a more full featured aligner, the scoring costs and given as a complex matrix. For example, the scoring system above can be represented by a scoring matrix (also known as a substitution matrix). The scoring matrix has one row and one column for each possible letter in our alphabet of letters (eg. 4 rows and 4 columns for DNA sequences). The (i,j) element of the matrix has a value of +2 in case of a match and -1 in case of a mismatch. To make alignments of protein sequences, it is necessary to use a scoring matrix for amino acids rather than for nucleotides. Traditionally the BLOSUM matrices are used for this scoring, but for the purposes of this exercise we can use the simple scoring costs and penalties above.)

For more information and how to do this using an R package, see the chapter "Pairwise Sequence Alignment" at http://a-little-book-of-r-for-bioinformatics.readthedocs.org/en/latest/src/chapter4.html. The key algorithm is Needleman-Wunsch (http://en.wikipedia.org/wiki/Needleman%E2%80%93Wunsch_algorithm).

For this challenge your task is to write a program that accepts two sequences and globally aligns them. If you want to make this harder and integrate the BLOSUM matrices, you may.

Input Description

You'll be given two sequences on two lines, one line per sequence. They'll be the same type of input, DNA or protein.

Output Description

Your program should emit the aligned sequences with gaps introduced represented by dashed ("-").

Input

DNA example

ACGTACGTACGTACGTACGTACGTACGTACGTACGTACGTACGTACGTAC
ACGTACGTACGTACGTACGTACGTACGTACGTACGTACGTACGTAC

Protein example

MTNRTLSREEIRKLDRDLRILVATNGTLTRVLNVVANEEIVVDIINQQLLDVAPKIPELENLKIGRILQRDILLKGQKSGILFVAAESLIVIDLLPTAITTYLTKTHHPIGEIMAASRIETYKEDAQVWIGDLPCWLADYGYWDLPKRAVGRRYRIIAGGQPVIITTEYFLRSVFQDTPREELDRCQYSNDIDTRSGDRFVLHGRVFKN
MLAVLPEKREMTECHLSDEEIRKLNRDLRILIATNGTLTRILNVLANDEIVVEIVKQQIQDAAPEMDGCDHSSIGRVLRRDIVLKGRRSGIPFVAAESFIAIDLLPPEIVASLLETHRPIGEVMAASCIETFKEEAKVWAGESPAWLELDRRRNLPPKVVGRQYRVIAEGRPVIIITEYFLRSVFEDNSREEPIRHQRSVGTSARSGRSICT

Output

DNA example

ACGTACGTAC GTACGTACGT ACGTACGTAC GTACGTACGT ACGTACGTAC
ACGTACGTAC GTACGTACGT ----ACGTAC GTACGTACGT ACGTACGTAC

Protein example

MT-----NR--T---LSREEIRKLDRDLRILVATNGTLTRVLNVVANEEIVVDIINQQLLDVAPKIPELENLKIGRILQRDILLKGQKSGILFVAAESLIVIDLLPTAITTYLTKTHHPIGEIMAASRIETYKEDAQVWIGDLPCWLADYGYWDLPKRAVGRRYRIIAGGQPVIITTEYFLRSVFQDTPREELDRCQYSNDIDTRSGDRFVLHGRVFKN
MLAVLPEKREMTECHLSDEEIRKLNRDLRILIATNGTLTRILNVLANDEIVVEIVKQQIQDAAPEMDGCDHSSIGRVLRRDIVLKGRRSGIPFVAAESFIAIDLLPPEIVASLLETHRPIGEVMAASCIETFKEEAKVWAGESPAWLELDRRRNLPPKVVGRQYRVIAEGRPVIIITEYFLRSVFEDNSREEPIRHQRS--VGT-SA-R---SGRSICT
Sign up for free to join this conversation on GitHub. Already have an account? Sign in to comment