This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
def win(clouds): | |
print(clouds) | |
now_on = -1 | |
jumps = 0 | |
if clouds[-1] == 1: | |
print("invalid game! ends with a thunderhead.") | |
return None | |
while True: |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
<?xml version="1.0" encoding="UTF-8"?> | |
<project xmlns="http://maven.apache.org/POM/4.0.0" | |
xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" | |
xsi:schemaLocation="http://maven.apache.org/POM/4.0.0 http://maven.apache.org/xsd/maven-4.0.0.xsd"> | |
<modelVersion>4.0.0</modelVersion> | |
<groupId>ai.grakn</groupId> | |
<artifactId>twitterexample</artifactId> | |
<version>1.0-SNAPSHOT</version> |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
insert | |
"production" sub entity | |
is-abstract | |
## Filming details | |
plays production-with-crew | |
plays production-with-cast | |
plays production-with-company | |
plays production-with-location |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
sequence-function-mapping sub relationship, | |
relates mapping-sequence, | |
relates mapped-function; | |
implied-sequence-function-mapping sub rule, | |
when { | |
$seq isa sequence; | |
$struct isa structure; | |
$func isa function; | |
(mapping-sequence: $seq, mapped-structure: $struct) isa sequence-structure-mapping; |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
match | |
$target-sequence isa sequence "MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQIHFVLNTVSLMSVLIPKLPQLHGVRIFGINKY"; | |
$direct-function isa function; | |
(mapping-sequence: $target-sequence, mapped-function: $direct-function) isa sequence-function-mapping; | |
$similar-sequence isa sequence; | |
$alignment (target-sequence: $target-sequence, matched-sequence: $similar-sequence) isa sequence-sequence-alignment; | |
$alignment has identicality > 0.8; | |
$indirect-function isa function; | |
(mapping-sequence: $similar-sequence, mapped-function: $indirect-function) isa sequence-function-mapping; | |
get $direct-function, $indirect-function; |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
match | |
$target-function isa function "enzyme"; | |
$sequence isa sequence; | |
(mapping-sequence: $sequence, mapped-function: $target-function) isa sequence-function-mapping; | |
get $sequence; |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
match | |
$target-sequence isa sequence "MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQIHFVLNTVSLMSVLIPKLPQLHGVRIFGINKY"; | |
$similar-sequence isa sequence; | |
$alignment (target-sequence: $target-sequence, matched-sequence: $similar-sequence) isa sequence-sequence-alignment; | |
$alignment has identicality > 0.8; | |
$structure isa structure; | |
(mapping-sequence: $similar-sequence, mapped-structure: $structure) isa sequence-structure-mapping; | |
get $structure; |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
match | |
$target-structure isa strucuture has pdb-id "2RHC"; | |
$sequence isa sequence; | |
(mapping-sequence: $sequence, mapped-structure: $target-structure) isa sequence-structure-mapping; | |
get $sequence; |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
match | |
$target-sequence isa sequence "MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTNLIHNMGMYIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYDQIHFVLNTVSLMSVLIPKLPQLHGVRIFGINKY"; | |
$structure isa structure; | |
(mapping-sequence: $target-sequence, mapped-structure: $structure) isa sequence-structure-mapping; | |
get $structure; |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
package ai.grakn.examples; | |
import ai.grakn.GraknTxType; | |
import ai.grakn.Keyspace; | |
import ai.grakn.client.Grakn; | |
import ai.grakn.util.SimpleURI; | |
/** | |
* a lean JSON Library for Java, | |
* @see <a href="https://bolerio.github.io/mjson/">mjson</a> |
NewerOlder