This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| #!/usr/bin/env bash | |
| # | |
| # Copyright 2013-2026, Seqera Labs | |
| # | |
| # Licensed under the Apache License, Version 2.0 (the "License"); | |
| # you may not use this file except in compliance with the License. | |
| # You may obtain a copy of the License at | |
| # | |
| # http://www.apache.org/licenses/LICENSE-2.0 | |
| # |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| workflow { | |
| def statham = new groovy.json.JsonSlurper() | |
| updates = Channel.topic('model_updates') | |
| limit = updates.until { path -> statham.parseText(path.text).score >= 100 } | |
| Setup() | |
| Model(updates, limit) | |
| Model.out.last().view { model -> "Last model: ${model.text}" } |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| nextflow.preview.topic = true | |
| workflow { | |
| def statham = new groovy.json.JsonSlurper() | |
| Channel.topic('model_updates') | |
| .tap { updates } | |
| .map { path -> statham.parseText(path.text) } | |
| .until { obj -> obj?.score > 100 } | |
| .tap { limit } |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| #!/usr/bin/env nextflow | |
| nextflow.preview.output = true | |
| /* | |
| * Pipeline parameters | |
| */ | |
| // Primary input (file of input files, one per line) | |
| params.reads_bam = "${projectDir}/data/sample_bams.txt" | |
| // Output directory |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| >HWR61437.1 MAG TPA: tetrahydromethanopterin S-methyltransferase subunit E, partial [Clostridia bacterium] | |
| ALMGAAATIAGAAEDLESDIGSMSNPNSQVQLAPQMGHLHRMFNKAISGEPVQMGTLAGIAGSVAYVLIG | |
| SVHLPVIMSIAAGGFIAALFHTAFATTSYLGRIVGQSQFNQPVFMDVITSHLGPIAAHGFIVTFCIVGLS | |
| YLMNTVLQPTHPFPLPLLAVLWGITIGAIGSSTGDVHYGAEREYQTYPFGGGIPVAIHGDITTKAELGAR | |
| NSIDVVHFCAKFGGPVTGFCFGLIVFLSFWVTVVFGPTGGVIAGLVIILLLIILNNRIEIFARNSYGPYK | |
| E |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| #!/usr/bin/env nextflow | |
| params.outdir = 'results' | |
| params.all = false | |
| workflow { | |
| First() | |
| First.out.value | Second | |
| Second.out.value | Third |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| #!/usr/bin/env nextflow | |
| params.outdir = 'results' | |
| params.all = false | |
| workflow { | |
| First() | |
| First.out.value | Second | |
| Second.out.value | Third |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| process A { | |
| input: val(name) | |
| output: tuple val(name), path("*") | |
| script: "echo hello $name > greeting.${name}.txt" | |
| } | |
| process B { | |
| input: val(name) | |
| output: tuple val(name), path("*") | |
| script: "echo goodbye $name > farewell.${name}.txt" |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| #!/usr/bin/env nextflow | |
| nextflow.enable.dsl=2 | |
| nextflow.preview.recursion=true | |
| params.input = 'data/*.dat' | |
| process ScannerLightly { | |
| input: | |
| path datfile_accumulator | |
| val meta_accumulator |
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| #!/usr/bin/env ruby | |
| require 'json' | |
| require 'optparse' | |
| options = {} | |
| OptionParser.new do |opt| | |
| opt.on('--report FILENAME') { |report| options[:report] = report } | |
| end.parse! |
NewerOlder